Potri.012G009800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27585 382 / 1e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G54100 365 / 5e-124 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT3G01290 74 / 1e-14 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G62740 60 / 6e-10 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
AT5G51570 58 / 4e-09 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G005500 557 / 0 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G011345 494 / 6e-176 AT4G27585 268 / 2e-87 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G001900 486 / 3e-171 AT4G27585 499 / 2e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G010001 410 / 3e-143 AT4G27585 245 / 6e-79 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078100 57 / 4e-09 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.017G078000 57 / 9e-09 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.015G130600 54 / 9e-08 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Potri.012G129000 51 / 5e-07 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032909 394 / 8e-135 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015597 272 / 3e-86 AT4G27585 383 / 7e-130 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015356 59 / 2e-09 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10007268 57 / 7e-09 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10015032 56 / 2e-08 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10004268 55 / 4e-08 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10038907 54 / 9e-08 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Lus10036715 50 / 1e-06 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
Lus10037213 50 / 1e-06 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0433 SPFH PF01145 Band_7 SPFH domain / Band 7 family
Representative CDS sequence
>Potri.012G009800.4 pacid=42783105 polypeptide=Potri.012G009800.4.p locus=Potri.012G009800 ID=Potri.012G009800.4.v4.1 annot-version=v4.1
ATGTGGAGGAGGAGGAGTCATTTATTACTCAGCAACGCCGTAAGAACCTCCCACCACCTCTCCTCCTTATCGGCTTCCACCGCTTCCAGAGGCAGAACCC
TCCTCACTCCCTCCTCCAATTCTCCCTTATTTAAACCCCCTTCTCTTCACTTAGCCCCAAACAACCGCCTTTCCTCTCCTCTCTCCTCCACCATCTCCGT
CCGCCTCCTCACCGGCCGCGACCCCTTCACCAGTTATGAGATTACGCCACCTGTGAATTGGGGGATACGGATTGTGCTGGAGAAGAAAGCGTTTGTGGTA
GAGAGATTTGGAAAGTACTTGAAGACGCTGCCATCTGGAATCCATTTCTTGATTCCTCTTGTCGATCGAATCGCTTATGTTCACTCTTTGAAGGAAGAGG
CTATTCAGATTCCTGATCAATCTGCTATTACCAAAGACAATGTCAGCATTCTTATCGGCGGCGTCCTCTATGTCAAGATTGTGGATCCTAAGCTTGCCTC
TTATGGTGTTGAGAATCCCATCTATGCTGTCGTTCAACTTGCCCAGACAACTATGCGTAGTGAGCTTGGTAAGATTACTCTTGACAAGACCTTTGAAGAA
AGAGACACTCTAAACGAAAAGATTGTGGAGGCCATCAATGTGGCTGCAACAGACTGGGGTCTCCGATGTCTTCGTTATGAAATAAGGGATATATCTCCTC
CACGTGGGGTGAAGCAAGCTATGGAGATGCAGGCAGAAGCAGAACGTAGAAAGAGAGCTCAAATTCTTGAGTCTGAAGGAGAGAGACAGGCCAATATTAA
TATTGCTGATGGTCATAAGAGTGCTCAGATCTTGGCATCACAAGGAGAGAAACAAGCTCTCATCAACAAAGCACAAGGTGAGGCTGAAGCCATCATTGCT
AAAGCACAAGCAACAGCCAAAGGAATTGCCATTGTGTCAGAGAATATTAAAAAGAGTGGGGGGATTGAGGCAGTACATCTTCACCCAGGACCACAAAAGG
AGAATTCCCTATCCATACCATGGCTACATTCAGCAGTCTCATTCGTGTCATCAATTCTTGCTCCATCTATTCTAGCTTCCATTGGCTCCTCAGAACAAAA
TTGCTCAGCAGCAGCATATGATGATTTGAGAGAATCATGTTGGGAGGATTCTAAAGTATCAAAGTTGGAAGGATTCAACTTCCCAGCCCAATTTTCCACG
ACCTTCTTTTTATCAACCCTACTTGAATTAACCTCTAAGCATGGTTTTTCTGTAACTTTAATGGCAAAGACCGAACCACTAATCTCCACCTAA
AA sequence
>Potri.012G009800.4 pacid=42783105 polypeptide=Potri.012G009800.4.p locus=Potri.012G009800 ID=Potri.012G009800.4.v4.1 annot-version=v4.1
MWRRRSHLLLSNAVRTSHHLSSLSASTASRGRTLLTPSSNSPLFKPPSLHLAPNNRLSSPLSSTISVRLLTGRDPFTSYEITPPVNWGIRIVLEKKAFVV
ERFGKYLKTLPSGIHFLIPLVDRIAYVHSLKEEAIQIPDQSAITKDNVSILIGGVLYVKIVDPKLASYGVENPIYAVVQLAQTTMRSELGKITLDKTFEE
RDTLNEKIVEAINVAATDWGLRCLRYEIRDISPPRGVKQAMEMQAEAERRKRAQILESEGERQANINIADGHKSAQILASQGEKQALINKAQGEAEAIIA
KAQATAKGIAIVSENIKKSGGIEAVHLHPGPQKENSLSIPWLHSAVSFVSSILAPSILASIGSSEQNCSAAAYDDLRESCWEDSKVSKLEGFNFPAQFST
TFFLSTLLELTSKHGFSVTLMAKTEPLIST

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G27585 SPFH/Band 7/PHB domain-contain... Potri.012G009800 0 1
AT4G27585 SPFH/Band 7/PHB domain-contain... Potri.012G011345 2.00 0.8008
AT4G27585 SPFH/Band 7/PHB domain-contain... Potri.012G005500 3.00 0.7539
AT1G12300 Tetratricopeptide repeat (TPR)... Potri.017G133501 8.94 0.5968
Potri.019G106950 28.61 0.5548
AT5G64200 ATSC35, At-SC35 ARABIDOPSIS THALIANA ORTHOLOG ... Potri.002G095800 29.69 0.5731
AT3G15040 Protein of unknown function, D... Potri.016G076300 31.74 0.5221
AT1G19490 bZIP Basic-leucine zipper (bZIP) tr... Potri.006G114600 34.05 0.5777
AT3G51710 D-mannose binding lectin prote... Potri.016G132500 44.45 0.4771
AT4G25300 2-oxoglutarate (2OG) and Fe(II... Potri.009G025900 46.74 0.5132
AT2G34520 RPS14 mitochondrial ribosomal protei... Potri.001G424950 53.60 0.5280

Potri.012G009800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.