Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G24165 90 / 3e-25 unknown protein AT4G23885 59 / 3e-13 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.003G140300 [exp] 72 / 4e-18 AT4G23885 85 / 2e-23 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10014921 [exp] 79 / 8e-21 AT5G24165 80 / 2e-21 unknown protein Lus10038814 [exp] 72 / 1e-16 AT5G38250 165 / 2e-46 Protein kinase family protein (.1) Lus10001827 [exp] 64 / 7e-15 AT4G23885 86 / 6e-24 unknown protein Lus10003881 [exp] 59 / 2e-12 AT4G23885 75 / 1e-18 unknown protein
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G011600.2 pacid=42782740 polypeptide=Potri.012G011600.2.p locus=Potri.012G011600 ID=Potri.012G011600.2.v4.1 annot-version=v4.1 ATGGGAGGAGCAGCAGCAGCAGCAGCACACGCAGTCAAGAGAATTCCACGCATCAAATTCCCTCAAAGACACGCAAAATCTTCATCTTCAGGGTTTGTAC CGCAAACTCAAGCTGCGTCAACAGATACAGAGATTCATCATTTTATCATGTCAAGCTCAGAAGTTCCCGCATCACCAGCCAATATTGCCGAGGGAGGCAA AGCTTCTCTTCAGCCAAAACGCACACCTGTCTCAGAAAGGGAAATTGAGGCTGTTCAGCTGGGCGGCATCTTCTGA
AA sequence Show only first row Show all	>Potri.012G011600.2 pacid=42782740 polypeptide=Potri.012G011600.2.p locus=Potri.012G011600 ID=Potri.012G011600.2.v4.1 annot-version=v4.1 MGGAAAAAAHAVKRIPRIKFPQRHAKSSSSGFVPQTQAASTDTEIHHFIMSSSEVPASPANIAEGGKASLQPKRTPVSEREIEAVQLGGIF

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G24165			unknown protein		Potri.012G011600 [exp]	0	1
AT3G05070			unknown protein		Potri.004G067300 [exp]	1.00	0.8539
AT1G07020			unknown protein		Potri.009G077700 [exp]	9.05	0.7874	CALS1.1
AT1G75950		UIP1, SKP1A, AT...	UFO INTERACTING PROTEIN 1, ARA...		Potri.005G243100 [exp]	12.00	0.7744	Pt-SKP1.3
AT5G19590			Protein of unknown function, D...		Potri.006G158952 [exp]	17.77	0.8459
AT3G22630		PRCGB, PBD1	20S proteasome beta subunit D1...		Potri.010G084800 [exp]	33.46	0.7877	PBD2.2
AT5G03905			Iron-sulphur cluster biosynthe...		Potri.006G084300 [exp]	36.00	0.8180
AT1G31340		NEDD8, ATRUB1, ...	ARABIDOPSIS THALIANA RELATED T...		Potri.005G198700 [exp]	41.42	0.8067	SUBI.4
AT5G40190			RNA ligase/cyclic nucleotide p...		Potri.001G350300 [exp]	180.67	0.7549
AT5G03110			unknown protein		Potri.006G130500 [exp]	252.90	0.7572

Compare expression of checked genes

Potri.012G011600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.