Potri.012G012600 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G60370 49 / 4e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G012100 206 / 3e-67 ND /
Potri.012G012300 167 / 4e-52 ND /
Potri.014G045600 49 / 5e-07 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042897 52 / 6e-08 AT3G60370 312 / 8e-109 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Lus10028194 51 / 1e-07 AT3G60370 305 / 2e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0487 FKBP PF00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence
>Potri.012G012600.1 pacid=42783818 polypeptide=Potri.012G012600.1.p locus=Potri.012G012600 ID=Potri.012G012600.1.v4.1 annot-version=v4.1
ATGATTTCCTCTCGGGCTTTCTCTCTCACGAGCAAGCCATTCCTTCCCGCCACATGTCGCTCGTTCGGGACTTTCTACGGTCATGAGAACCGTAACATTA
TTCGCAGCTTCAAGGTTGCCAGACTATGGCACAAAAATTACATGCTACAAAGTAAGGAGATTCCGAAATGCAGTCATCGCCTCTCGTTTTTCATCTCGTA
TTCAACGGATTTATCAGGAAGTGACGATTTCCCTACGTTTGAACGGAAGGGAGATGATGTTAAGGTAAAGGTATCGTCTGCCTACGAATCGATTAAGACA
AAGGGATTGTCACCCTCCAAATGGATATACTTCAGGCACGTAGATGACGGCAGTGGTGACGTTAGTGTAAAGGACCAGAAGGTACAAATTCACTACCGGG
TCTTTGATAAAGAAAAAAAAGAGCTTGACAAAACTTACCACCCAAAACGCGGTCCTGAAATAATAGGTCCAGGCGAGAACGATATCTGTCAAGGCTTGTA
TGAAGGAATTGTGGGCATGCGAAAAGGGGAAAGAAGAATCATCGTCCTTCCACCGTCTTCGGATTTGACCGGTGACCACCGAAAGAGTTCATGGAGTCAT
CTCCCGAAATTCATGACGGGGAAACTGTCCAGTTACTCCGAAGAACATAGAATCTATGATGTGCGCTTGGTCGAAATCATTGGATGA
AA sequence
>Potri.012G012600.1 pacid=42783818 polypeptide=Potri.012G012600.1.p locus=Potri.012G012600 ID=Potri.012G012600.1.v4.1 annot-version=v4.1
MISSRAFSLTSKPFLPATCRSFGTFYGHENRNIIRSFKVARLWHKNYMLQSKEIPKCSHRLSFFISYSTDLSGSDDFPTFERKGDDVKVKVSSAYESIKT
KGLSPSKWIYFRHVDDGSGDVSVKDQKVQIHYRVFDKEKKELDKTYHPKRGPEIIGPGENDICQGLYEGIVGMRKGERRIIVLPPSSDLTGDHRKSSWSH
LPKFMTGKLSSYSEEHRIYDVRLVEIIG

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G60370 FKBP-like peptidyl-prolyl cis-... Potri.012G012600 0 1
AT2G44930 Plant protein of unknown funct... Potri.012G012500 1.00 0.9758
AT2G02450 NAC LOV1, ANAC034, ... LONG VEGETATIVE PHASE 1, Arabi... Potri.004G230800 2.00 0.9727
AT2G44930 Plant protein of unknown funct... Potri.012G012000 2.44 0.9702
Potri.012G012100 3.46 0.9598
AT4G03400 GH3-10, DFL2 DWARF IN LIGHT 2, Auxin-respon... Potri.013G144300 5.29 0.9220 10,Pt-DFL2.2
AT1G06690 NAD(P)-linked oxidoreductase s... Potri.005G207100 5.47 0.9476
AT2G44930 Plant protein of unknown funct... Potri.012G012202 6.32 0.9301
AT5G43745 Protein of unknown function (D... Potri.010G078600 7.54 0.8898
AT3G59780 Rhodanese/Cell cycle control p... Potri.013G128300 9.00 0.9273
AT4G22980 unknown protein Potri.001G111600 9.38 0.9149

Potri.012G012600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.