Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G35520 50 / 4e-08 ARF ARF15 auxin response factor 15 (.1) AT4G01500 49 / 8e-08 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) AT2G46870 46 / 8e-07 B3 NGA1 NGATHA1, AP2/B3-like transcriptional factor family protein (.1) AT1G34390 46 / 1e-06 ARF ARF22 auxin response factor 22 (.1) AT4G21550 45 / 2e-06 B3 HSI2-L2, VAL3 VP1/ABI3-like 3 (.1) AT1G01030 44 / 4e-06 B3 NGA3 NGATHA3, AP2/B3-like transcriptional factor family protein (.1) AT3G61970 44 / 5e-06 B3 NGA2 NGATHA2, AP2/B3-like transcriptional factor family protein (.1) AT1G34310 44 / 7e-06 ARF ARF12 auxin response factor 12 (.1) AT4G30080 43 / 1e-05 ARF ARF16 auxin response factor 16 (.1) AT1G34410 43 / 2e-05 ARF ARF21 auxin response factor 21 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G012850 [exp] 228 / 6e-79 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G016901 [exp] 174 / 8e-58 AT1G34390 49 / 1e-07 auxin response factor 22 (.1) Potri.015G016700 [exp] 169 / 7e-56 AT1G34390 46 / 1e-06 auxin response factor 22 (.1) Potri.015G017000 [exp] 168 / 2e-55 AT1G34390 52 / 1e-08 auxin response factor 22 (.1) Potri.015G016450 [exp] 166 / 2e-54 AT4G01500 47 / 4e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G014850 [exp] 162 / 7e-53 AT4G01500 45 / 3e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015501 [exp] 160 / 2e-52 AT1G13260 46 / 1e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G015275 [exp] 160 / 2e-52 AT4G01500 44 / 4e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015650 [exp] 159 / 6e-52 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026212 [exp] 50 / 4e-08 AT1G51120 150 / 4e-44 AP2/B3 transcription factor family protein (.1) Lus10030240 [exp] 49 / 1e-07 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10041340 [exp] 46 / 1e-06 AT3G61830 370 / 2e-122 auxin response factor 18 (.1) Lus10021326 [exp] 45 / 4e-06 AT5G06250 202 / 2e-63 AP2/B3-like transcriptional factor family protein (.1.2) Lus10019940 [exp] 43 / 1e-05 AT4G30080 660 / 0.0 auxin response factor 16 (.1) Lus10026510 [exp] 43 / 1e-05 AT4G30080 694 / 0.0 auxin response factor 16 (.1) Lus10041487 [exp] 43 / 1e-05 AT1G13260 416 / 8e-146 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Lus10023519 [exp] 43 / 2e-05 AT4G30080 622 / 0.0 auxin response factor 16 (.1) Lus10040403 [exp] 42 / 2e-05 AT4G30080 625 / 0.0 auxin response factor 16 (.1) Lus10034276 [exp] 42 / 3e-05 AT1G68840 233 / 4e-76 TEMPRANILLO 2, RELATED TO AP2 8, ETHYLENE RESPONSE DNA BINDING FACTOR 2, related to ABI3/VP1 2 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.012G012950.1 pacid=42783218 polypeptide=Potri.012G012950.1.p locus=Potri.012G012950 ID=Potri.012G012950.1.v4.1 annot-version=v4.1 ATGGCAAGATTCTCAAAGATCCTCAGCAAGACTGATATTAAGAAGAGACTGACAGTGCCTATCAAGTTTCTCAAATCTCTTCCATCATTCGACGGGGGCC ATGCCGTAAAGTTTGAAGCTAGAGATGAGGGAGGCGAAGCCTGGGCCTTTCAGTGCTCCGTCCGCCGGAGAGGGCACCCGAAGCCAGTACTTACACGGGG TTGGAAGGAATTCATCAACAGCAAGAAACTTAAAACTGGCGACAAGGTCAGTTTTATTAAATGTAAGAATCGAGCTACCGCAAAAACCTCTTACAGAGTT CGCGCTGAAAAGGAAATCAAGATCTTTGGAGCTATTATTGGGTATGCTCCATTGTAG
AA sequence Show only first row Show all	>Potri.012G012950.1 pacid=42783218 polypeptide=Potri.012G012950.1.p locus=Potri.012G012950 ID=Potri.012G012950.1.v4.1 annot-version=v4.1 MARFSKILSKTDIKKRLTVPIKFLKSLPSFDGGHAVKFEARDEGGEAWAFQCSVRRRGHPKPVLTRGWKEFINSKKLKTGDKVSFIKCKNRATAKTSYRV RAEKEIKIFGAIIGYAPL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G35520	ARF	ARF15	auxin response factor 15 (.1)		Potri.012G012950 [exp]	0	1
AT4G01500	B3	NGA4	NGATHA4, AP2/B3-like transcrip...		Potri.012G013700 [exp]	1.00	0.9459
AT1G01980		ATSEC1A	FAD-binding Berberine family p...		Potri.011G158500 [exp]	3.87	0.9061
AT5G38710			Methylenetetrahydrofolate redu...		Potri.004G106400 [exp]	4.58	0.9145
AT1G32740			SBP (S-ribonuclease binding pr...		Potri.003G085800 [exp]	6.00	0.8660
AT3G01980			NAD(P)-binding Rossmann-fold s...		Potri.001G327800 [exp]	7.74	0.8489
AT2G46620			P-loop containing nucleoside t...		Potri.002G175600 [exp]	8.00	0.8887
AT3G14390			Pyridoxal-dependent decarboxyl...		Potri.005G246300 [exp]	8.48	0.8406
AT4G17090		CT-BMY, BMY8, B...	BETA-AMYLASE 8, BETA-AMYLASE 3...		Potri.001G148900 [exp]	10.39	0.8973	Pt-BMY.1
AT3G54540		ABCF4, ATGCN4	ATP-binding cassette F4, gener...		Potri.008G003300 [exp]	11.48	0.8744	GCN4.3
AT3G54680			proteophosphoglycan-related (....		Potri.013G072200 [exp]	12.32	0.8612

Compare expression of checked genes

Potri.012G012950 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.