Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G43950 48 / 1e-07 ARF ARF23 auxin response factor 23 (.1) AT1G34310 48 / 2e-07 ARF ARF12 auxin response factor 12 (.1) AT1G34390 48 / 2e-07 ARF ARF22 auxin response factor 22 (.1) AT1G35520 46 / 9e-07 ARF ARF15 auxin response factor 15 (.1) AT1G35540 44 / 4e-06 ARF ARF14 auxin response factor 14 (.1) AT1G34410 43 / 1e-05 ARF ARF21 auxin response factor 21 (.1) AT4G31690 43 / 1e-05 B3 REM9 Transcriptional factor B3 family protein (.1) AT4G01500 43 / 1e-05 B3 NGA4 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) AT1G35240 40 / 0.0001 ARF ARF20 auxin response factor 20 (.1) AT4G21550 40 / 0.0001 B3 HSI2-L2, VAL3 VP1/ABI3-like 3 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G013000 [exp] 176 / 2e-58 AT4G01500 46 / 9e-07 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015275 [exp] 159 / 2e-51 AT4G01500 44 / 4e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015501 [exp] 157 / 7e-51 AT1G13260 46 / 1e-06 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.012G013700 [exp] 157 / 8e-51 AT4G01500 52 / 6e-09 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G014850 [exp] 156 / 2e-50 AT4G01500 45 / 3e-06 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.012G012950 [exp] 155 / 2e-50 AT1G35520 49 / 9e-08 auxin response factor 15 (.1) Potri.012G012850 [exp] 154 / 1e-49 AT4G01500 49 / 6e-08 NGATHA4, AP2/B3-like transcriptional factor family protein (.1) Potri.015G015650 [exp] 154 / 1e-49 AT1G13260 50 / 6e-08 ETHYLENE RESPONSE DNA BINDING FACTOR 4, related to ABI3/VP1 1 (.1) Potri.015G016901 [exp] 151 / 1e-48 AT1G34390 49 / 1e-07 auxin response factor 22 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030240 [exp] 48 / 3e-07 AT2G46530 381 / 1e-126 auxin response factor 11 (.1.2.3) Lus10013942 [exp] 40 / 0.0002 AT2G33860 579 / 0.0 ETTIN, AUXIN RESPONSE TRANSCRIPTION FACTOR 3, Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related (.1) Lus10005264 [exp] 39 / 0.0004 AT2G33860 580 / 0.0 ETTIN, AUXIN RESPONSE TRANSCRIPTION FACTOR 3, Transcriptional factor B3 family protein / auxin-responsive factor AUX/IAA-related (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0405 [poplar] [flax] DNA_b-psBarrel PF02362 [poplar] [flax] B3 B3 DNA binding domain
Representative CDS sequence Show only first row Show all	>Potri.012G013167.1 pacid=42783201 polypeptide=Potri.012G013167.1.p locus=Potri.012G013167 ID=Potri.012G013167.1.v4.1 annot-version=v4.1 ATGACAACCTTCTCTAAGATCCTTCGCAAGACAGACACCAGCAAAGCACTGTCAGTGCCTACGAAGTATCTCAAGTCTCTCCCATCTTTCAAAGGTGGAC ATGCCGTGGAATTTCAAGCAATAGATGAGAGTGGCTTCGTCTGGACCTTTCAGTGTTCTATTCGCAAGAAAGGACACCCGAAGCCAGTTCTTTCAAAGGG CTGGCGTGCATTCGTTCGCAACAAGAAGCTTAAAGTTGGCGACAAGATCAAATTTTCCTTGAACCAAACCGCTGCAACACCCTTTTACAGGGTTCGAGCT GAAAAGGAAGTTAAGATCTTTCGTGCTATCTTTGGCTATTCACCCATCATAGCCACATTTCCATGA
AA sequence Show only first row Show all	>Potri.012G013167.1 pacid=42783201 polypeptide=Potri.012G013167.1.p locus=Potri.012G013167 ID=Potri.012G013167.1.v4.1 annot-version=v4.1 MTTFSKILRKTDTSKALSVPTKYLKSLPSFKGGHAVEFQAIDESGFVWTFQCSIRKKGHPKPVLSKGWRAFVRNKKLKVGDKIKFSLNQTAATPFYRVRA EKEVKIFRAIFGYSPIIATFP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G43950	ARF	ARF23	auxin response factor 23 (.1)		Potri.012G013167 [exp]	0	1
					Potri.005G129350 [exp]	28.21	0.7365
AT2G44890		CYP704A1	"cytochrome P450, family 704, ...		Potri.012G131200 [exp]	36.90	0.7318
AT3G14470			NB-ARC domain-containing disea...		Potri.017G121700 [exp]	65.81	0.6864
AT2G18160	bZIP	GBF5, ATBZIP2	G-BOX BINDING FACTOR 5, basic ...		Potri.005G119300 [exp]	99.21	0.6800
AT3G59510			Leucine-rich repeat (LRR) fami...		Potri.017G028400 [exp]	120.08	0.6280
AT4G02350		SEC15B	exocyst complex component sec1...		Potri.002G203200 [exp]	129.90	0.6521

Compare expression of checked genes

Potri.012G013167 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.