Potri.012G013580 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G27680 49 / 6e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
AT5G53540 42 / 2e-05 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.012G015670 179 / 9e-61 AT5G53540 67 / 2e-14 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G017760 66 / 2e-15 AT4G27680 164 / 1e-50 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G027101 66 / 2e-15 AT4G27680 166 / 3e-51 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G027901 61 / 1e-13 AT5G53540 182 / 2e-57 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G022985 53 / 5e-11 AT5G53540 95 / 7e-25 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.015G007700 50 / 2e-08 AT4G27680 615 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.011G055212 45 / 7e-08 AT4G27680 84 / 8e-21 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Potri.012G025351 41 / 2e-05 AT4G27680 322 / 5e-109 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10008835 49 / 3e-08 AT4G27680 649 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
Lus10022361 49 / 3e-08 AT4G27680 632 / 0.0 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1)
PFAM info
Representative CDS sequence
>Potri.012G013580.1 pacid=42784288 polypeptide=Potri.012G013580.1.p locus=Potri.012G013580 ID=Potri.012G013580.1.v4.1 annot-version=v4.1
ATGAAGTGTGTGTCAAGAAACCTGAGCTCTTCTCACATGGGAAACTTCTTGGTCCACAAAAAGGGGTATTGTTATATGGACCTCCAGGCACCGGGAAGAC
CATGCTTTACATCAGCTATTGCCAAAGAGTCTGGAGTTGTTTGTATAAATGTGAGGATCTCTAATCTGATGAGCAAGTGGGCAATGCACAAAATCTTGGC
ACCTCAGATGACTATCAGGTTCAAGGCCATTGTCGTAGTCAGACTTGCAGAGAGTTCTTGGCACATCAACTAA
AA sequence
>Potri.012G013580.1 pacid=42784288 polypeptide=Potri.012G013580.1.p locus=Potri.012G013580 ID=Potri.012G013580.1.v4.1 annot-version=v4.1
MKCVSRNLSSSHMGNFLVHKKGYCYMDLQAPGRPCFTSAIAKESGVVCINVRISNLMSKWAMHKILAPQMTIRFKAIVVVRLAESSWHIN

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G53540 P-loop containing nucleoside t... Potri.012G013580 0 1
AT5G53540 P-loop containing nucleoside t... Potri.012G015670 1.00 0.9898
AT1G04520 PDLP2 plasmodesmata-located protein ... Potri.002G257300 1.41 0.8768
Potri.010G186750 1.73 0.8617
AT5G46460 Pentatricopeptide repeat (PPR)... Potri.001G267100 2.44 0.8381
AT2G35550 BBR_BPC BPC7, BBR/BPC7,... basic pentacysteine 7 (.1.2.3.... Potri.001G133900 2.64 0.8356
Potri.006G120901 5.29 0.8589
AT4G14103 F-box/RNI-like superfamily pro... Potri.001G395000 6.00 0.8289
Potri.003G183150 9.16 0.7897
AT4G30520 SARK SENESCENCE-ASSOCIATED RECEPTOR... Potri.018G101300 11.31 0.8317
AT5G20810 SAUR-like auxin-responsive pro... Potri.018G063400 12.00 0.8190

Potri.012G013580 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.