Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G07950 124 / 3e-38 DNA-directed RNA polymerase, subunit M, archaeal (.1) AT1G01210 116 / 4e-35 DNA-directed RNA polymerase, subunit M, archaeal (.1) AT2G38560 41 / 5e-05 RDO2, TFIIS REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.013G015000 [exp] 39 / 8e-05 AT3G25940 132 / 4e-41 TFIIB zinc-binding protein (.1) Potri.010G142500 [exp] 38 / 0.0001 AT4G16265 146 / 3e-47 RNA polymerases M/15 Kd subunit (.1) Potri.006G109300 [exp] 38 / 0.0007 AT2G38560 393 / 2e-136 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Potri.016G138100 [exp] 38 / 0.0007 AT2G38560 402 / 3e-140 REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10005984 [exp] 181 / 2e-60 AT1G01210 112 / 2e-33 DNA-directed RNA polymerase, subunit M, archaeal (.1) Lus10030228 [exp] 175 / 1e-57 AT4G07950 120 / 6e-36 DNA-directed RNA polymerase, subunit M, archaeal (.1) Lus10034247 [exp] 40 / 0.0002 AT2G38560 295 / 1e-98 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Lus10022735 [exp] 39 / 0.0002 AT2G38560 375 / 2e-129 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Lus10014178 [exp] 39 / 0.0003 AT2G38560 384 / 1e-132 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Lus10025131 [exp] 39 / 0.0004 AT2G38560 387 / 6e-134 REDUCED DORMANCY 2, transcript elongation factor IIS (.1) Lus10025215 [exp] 39 / 0.0004 AT2G38560 384 / 8e-133 REDUCED DORMANCY 2, transcript elongation factor IIS (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0167 [poplar] [flax] Zn_Beta_Ribbon PF01096 [poplar] [flax] TFIIS_C Transcription factor S-II (TFIIS)
Representative CDS sequence Show only first row Show all	>Potri.012G015900.1 pacid=42782496 polypeptide=Potri.012G015900.1.p locus=Potri.012G015900 ID=Potri.012G015900.1.v4.1 annot-version=v4.1 ATGGAATTTTGCCCAACATGTGGGATGCTATTGCGATATGAGACGCCAAATATGGGGCAAGCAGCTAGATTTTATTGCCCTACCTGTCCCTATTTCGCTT CGATTGAGAGCAGGGTTAAGATAAAGAGAAAGCAAAAGCTTGCTAAGAAAGAAATTGAACCTATTTTCACCCTCGAGGACATGAAGACAGGCGGTGCTGA AACTGATGCAACATGTCCCCATTGCAACTTCGGAAGGGCCTGTTTCCAGCAGATACAGATTAGATCAGCTGATGAGCCAGCAACAACATTTTACTTCTGC TTGAATGAGAAGTGTGGGAGGATGTGGCGTGAGGACTGA
AA sequence Show only first row Show all	>Potri.012G015900.1 pacid=42782496 polypeptide=Potri.012G015900.1.p locus=Potri.012G015900 ID=Potri.012G015900.1.v4.1 annot-version=v4.1 MEFCPTCGMLLRYETPNMGQAARFYCPTCPYFASIESRVKIKRKQKLAKKEIEPIFTLEDMKTGGAETDATCPHCNFGRACFQQIQIRSADEPATTFYFC LNEKCGRMWRED

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G07950			DNA-directed RNA polymerase, s...		Potri.012G015900 [exp]	0	1
AT3G09770		LOG2	LOSS OF GDU 2, RING/U-box supe...		Potri.016G089000 [exp]	1.00	0.9019
AT4G28910		NINJA	novel interactor of JAZ (.1.2....		Potri.006G162900 [exp]	4.00	0.8579
AT5G43960			Nuclear transport factor 2 (NT...		Potri.014G192900 [exp]	4.89	0.8844
AT5G15270			RNA-binding KH domain-containi...		Potri.004G123400 [exp]	4.89	0.8779
AT1G11120			unknown protein		Potri.019G103800 [exp]	8.94	0.8438
AT5G47320		RPS19	ribosomal protein S19 (.1)		Potri.013G129600 [exp]	11.00	0.8437
AT1G44820			Peptidase M20/M25/M40 family p...		Potri.002G085400 [exp]	12.84	0.8356
AT1G70000	MYB		myb-like transcription factor ...		Potri.015G069000 [exp]	13.96	0.8000
AT3G27010	TCP	ATTCP20, PCF1, ...	ARABIDOPSIS THALIANA TEOSINTE ...		Potri.001G327100 [exp]	14.49	0.8249	TCP20.1
AT5G05550	Trihelix		sequence-specific DNA binding ...		Potri.008G071300 [exp]	15.90	0.8227

Compare expression of checked genes

Potri.012G015900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.