Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G76940 167 / 1e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT1G21320 149 / 3e-44 nucleotide binding;nucleic acid binding (.1.2) AT3G13700 54 / 2e-08 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT2G42240 50 / 5e-07 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT2G47580 48 / 1e-06 U1A spliceosomal protein U1A (.1) AT2G30260 46 / 7e-06 U2B'' U2 small nuclear ribonucleoprotein B (.1) AT1G06960 45 / 1e-05 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT3G21215 42 / 0.0002 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G009000 [exp] 389 / 4e-139 AT1G76940 170 / 8e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.002G070200 [exp] 195 / 2e-62 AT1G76940 215 / 4e-70 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.006G224900 [exp] 124 / 3e-34 AT1G21320 122 / 2e-33 nucleotide binding;nucleic acid binding (.1.2) Potri.019G121400 [exp] 53 / 2e-08 AT2G30260 305 / 7e-106 U2 small nuclear ribonucleoprotein B (.1) Potri.002G203600 [exp] 52 / 8e-08 AT2G47580 349 / 1e-122 spliceosomal protein U1A (.1) Potri.003G035000 [exp] 51 / 2e-07 AT3G13700 348 / 3e-121 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.007G046600 [exp] 51 / 2e-07 AT2G42240 334 / 4e-115 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) Potri.013G153700 [exp] 50 / 2e-07 AT2G30260 297 / 8e-103 U2 small nuclear ribonucleoprotein B (.1) Potri.014G127800 [exp] 46 / 7e-06 AT2G47580 347 / 6e-122 spliceosomal protein U1A (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10018903 [exp] 184 / 5e-55 AT1G21320 182 / 5e-54 nucleotide binding;nucleic acid binding (.1.2) Lus10028599 [exp] 171 / 9e-53 AT1G21320 206 / 4e-66 nucleotide binding;nucleic acid binding (.1.2) Lus10028598 [exp] 124 / 1e-33 AT1G76940 135 / 9e-38 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10042240 [exp] 49 / 6e-07 AT2G30260 352 / 2e-124 U2 small nuclear ribonucleoprotein B (.1) Lus10026413 [exp] 49 / 9e-07 AT2G30260 350 / 1e-123 U2 small nuclear ribonucleoprotein B (.1) Lus10008424 [exp] 46 / 9e-06 AT2G47580 365 / 4e-129 spliceosomal protein U1A (.1) Lus10033388 [exp] 45 / 2e-05 AT3G21215 337 / 2e-115 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003358 [exp] 44 / 5e-05 AT2G47580 367 / 7e-130 spliceosomal protein U1A (.1) Lus10034844 [exp] 44 / 6e-05 AT3G21215 370 / 1e-128 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.012G019300.4 pacid=42784226 polypeptide=Potri.012G019300.4.p locus=Potri.012G019300 ID=Potri.012G019300.4.v4.1 annot-version=v4.1 ATGGCGGATAGTTACTGGAGATATGCCGGCGACTCACGGCAGCAGCCGCCGCAGTCCATGTCTTCTCTCACCGGAAAACGCCCTCGCATCGATTACGATA TCCCAAGCGGCCGTGACTTATCCAGTTATTATTCCCGTGATGATGATAGAGGGGCTCTTCATGTAATCAGAGATTCAGACTCCATCGGAGCATCTTATGA CCGTTACTTGCGTAGTGGGACAGTTTCATCTTATGGTGGGGGACAGTCTGCTAGAGCCATGAGTGGGGTGCCTAGTCATCCTGTTGATGACACACGCATG GTGAGTATGGGGCCCATGGACCCTGGGGCTAGTGTAAAAGACAGGTCATTGCGCATGGGAAGTGGAAGATCTGAGGTTTCCCTTCCTCCTGATGCTAGCA GCACACTGTTTGTGGAGGGCTTGCCTTCTGACTGTACACGACGGGAAGTTTCCCATATCTTTCGCCCTTTTGTTGGCTACAAAGAAGTGAGACTTGTAAG CAAGGAATCAAGACATCCTGGGGGAGATCCACTAGTACTCTGTTTTGTTGACTTTTTGAGTCCCGCACATGCTGCCACTGCCATGGATGCATTACAAGGT TATAGATTTGATGAGCATGACCGCGATTCGTTCCATTTAAGATTGCAATTTGCTCGCTATCCTGGTGCAAGGTCAGGTGGCGGGCATCGTGGCAAGCGTT GA
AA sequence Show only first row Show all	>Potri.012G019300.4 pacid=42784226 polypeptide=Potri.012G019300.4.p locus=Potri.012G019300 ID=Potri.012G019300.4.v4.1 annot-version=v4.1 MADSYWRYAGDSRQQPPQSMSSLTGKRPRIDYDIPSGRDLSSYYSRDDDRGALHVIRDSDSIGASYDRYLRSGTVSSYGGGQSARAMSGVPSHPVDDTRM VSMGPMDPGASVKDRSLRMGSGRSEVSLPPDASSTLFVEGLPSDCTRREVSHIFRPFVGYKEVRLVSKESRHPGGDPLVLCFVDFLSPAHAATAMDALQG YRFDEHDRDSFHLRLQFARYPGARSGGGHRGKR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G76940			RNA-binding (RRM/RBD/RNP motif...		Potri.012G019300 [exp]	0	1
AT1G80300		ATNTT1	nucleotide transporter 1 (.1)		Potri.003G058900 [exp]	7.41	0.8901	AATP1.2
AT1G08970	CCAAT	NF-YC9, HAP5C	"nuclear factor Y, subunit C9"...		Potri.013G025000 [exp]	9.27	0.8664	Pt-HAP5.3
AT1G28200		FIP1	FH interacting protein 1 (.1)		Potri.002G102800 [exp]	10.00	0.8647	Pt-FIP1.3
AT4G24010		CSLG2, ATCSLG1	ARABIDOPSIS THALIANA CELLULOSE...		Potri.010G074700 [exp]	14.83	0.8447
AT1G02330			unknown protein		Potri.014G110200 [exp]	18.57	0.8039
AT1G68300			Adenine nucleotide alpha hydro...		Potri.008G121900 [exp]	20.90	0.8434
AT2G03530		ATUPS2, UPS2	ARABIDOPSIS THALIANA UREIDE PE...		Potri.008G095600 [exp]	22.78	0.8657
					Potri.001G077280 [exp]	23.87	0.8557
AT1G25520			Uncharacterized protein family...		Potri.008G117900 [exp]	24.53	0.8586
AT1G61560		ATMLO6, MLO6	MILDEW RESISTANCE LOCUS O 6, S...		Potri.009G011900 [exp]	28.35	0.8591

Compare expression of checked genes

Potri.012G019300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.