Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46780 161 / 1e-47 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G33470 148 / 9e-44 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT1G76460 138 / 2e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G20880 137 / 3e-39 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT1G22330 135 / 3e-38 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G78260 135 / 4e-38 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) AT5G11412 130 / 2e-37 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT1G22910 129 / 2e-36 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2), RNA-binding (RRM/RBD/RNP motifs) family protein (.3) AT5G53680 118 / 6e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G54770 118 / 6e-32 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G005500 [exp] 368 / 6e-130 AT2G46780 145 / 1e-41 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G179100 [exp] 204 / 5e-65 AT2G46780 275 / 2e-91 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.014G105101 [exp] 203 / 4e-64 AT2G46780 252 / 4e-82 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.019G068400 [exp] 155 / 3e-46 AT1G33470 246 / 7e-82 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.013G094400 [exp] 154 / 8e-46 AT1G33470 257 / 3e-86 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.002G004600 [exp] 143 / 4e-41 AT1G76460 377 / 9e-133 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.005G256700 [exp] 141 / 2e-40 AT1G76460 335 / 5e-116 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.002G098100 [exp] 132 / 5e-37 AT1G78260 164 / 5e-49 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Potri.008G044700 [exp] 130 / 9e-37 AT3G54770 234 / 6e-77 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030202 [exp] 167 / 5e-50 AT2G46780 224 / 2e-71 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10002684 [exp] 162 / 2e-48 AT2G46780 228 / 1e-72 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10036503 [exp] 129 / 3e-36 AT3G54770 156 / 5e-47 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10041423 [exp] 129 / 4e-36 AT3G54770 181 / 3e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10039151 [exp] 103 / 5e-26 AT1G33470 182 / 7e-57 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10023817 [exp] 90 / 1e-20 AT3G15010 188 / 5e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10021035 [exp] 88 / 2e-19 AT3G15010 182 / 4e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10038806 [exp] 84 / 2e-18 AT3G07810 417 / 2e-141 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10000537 [exp] 84 / 3e-18 AT3G07810 420 / 8e-143 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2) Lus10039054 [exp] 84 / 5e-18 AT3G07810 428 / 4e-147 RNA-binding (RRM/RBD/RNP motifs) family protein (.1), RNA-binding (RRM/RBD/RNP motifs) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.012G022100.1 pacid=42783676 polypeptide=Potri.012G022100.1.p locus=Potri.012G022100 ID=Potri.012G022100.1.v4.1 annot-version=v4.1 ATGTCTCAAGAGATCATGGAAAATAAGATGGTGATCAATGGAACTAATAGTGTTTCAGAATTCACTCGTGACACAACTTACACCAAGATTTTTGTTGGAG GATTGCCATGGGAGACTAGAAGTGATTCTTTACACAGGTATTTTGAGCAGTTTGGAGAGATCAAAGAAGCAGTTGTGATCATTGATAGGAGCACAGGAAG ATCAAAAGGATATGGCTTTGTAACTTTCAAGGATCCTGGTTCAGCAACAAGAGCTTGTCAAAATCCATATCCTGTTATTGATGGAAGGAGAGCCAACTGC AATCTTGCTGCCTTTGGTGCACAAAAGAAAGCTGCAGGAACTGATAAACTTGGACCTGCAGCATCAAGATCCATCACACCATTAAACACTCATGGCCCTT CTGCGTACTTCAATCAACAAATACCTCAATATGCATTTCCTAATTCAGTTTTTGGGTATCCTATCTACCCACAGAGCACTTATGCAATGAATAATTTTTA CAATGCATACGGAGGGAAACAGTTTCCATTCTATTACCCCGCCGCGGCACCAGGTTCCCCTGGAGTCTACATGAATTACTATCCACTCTATGCTCAACAT GGACAAAACAGCCCAAGTCACTACCCAAAAATGATGCACAACTCTCAGCAACACAATGCTCTTGGGACCTTATCGAATCCTACTTCAGCTTCCTCCTCAC TACCAATTACCAAAGCAAGACCTGCCGCGGCAGCAGAACAAACAGCAATGAGAGTGCCAGGAACTGTATCTGAACAGAAGAAATAG
AA sequence Show only first row Show all	>Potri.012G022100.1 pacid=42783676 polypeptide=Potri.012G022100.1.p locus=Potri.012G022100 ID=Potri.012G022100.1.v4.1 annot-version=v4.1 MSQEIMENKMVINGTNSVSEFTRDTTYTKIFVGGLPWETRSDSLHRYFEQFGEIKEAVVIIDRSTGRSKGYGFVTFKDPGSATRACQNPYPVIDGRRANC NLAAFGAQKKAAGTDKLGPAASRSITPLNTHGPSAYFNQQIPQYAFPNSVFGYPIYPQSTYAMNNFYNAYGGKQFPFYYPAAAPGSPGVYMNYYPLYAQH GQNSPSHYPKMMHNSQQHNALGTLSNPTSASSSLPITKARPAAAAEQTAMRVPGTVSEQKK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46780			RNA-binding (RRM/RBD/RNP motif...		Potri.012G022100 [exp]	0	1
AT1G17050		SPS2	solanesyl diphosphate synthase...		Potri.011G101301 [exp]	2.82	0.8606
AT1G78080	AP2_ERF	CAF1, RAP2.4, W...	wound induced dedifferentiatio...		Potri.005G168700 [exp]	3.46	0.8501
AT1G17050		SPS2	solanesyl diphosphate synthase...		Potri.011G101200 [exp]	3.46	0.8590
AT2G46780			RNA-binding (RRM/RBD/RNP motif...		Potri.015G005500 [exp]	5.09	0.8178
AT1G31770		ABCG14	ATP-binding cassette G14, ATP-...		Potri.003G046800 [exp]	6.48	0.8310
AT1G78510		SPS1	solanesyl diphosphate synthase...		Potri.011G099500 [exp]	6.92	0.8377
AT2G18660		AtPNP-A, PNP-A,...	plant natriuretic peptide A (....		Potri.018G029100 [exp]	8.06	0.8372
					Potri.004G202050 [exp]	8.83	0.8479
AT1G11050			Protein kinase superfamily pro...		Potri.004G084900 [exp]	8.94	0.8409
AT5G08139			RING/U-box superfamily protein...		Potri.015G047900 [exp]	9.94	0.8424

Compare expression of checked genes

Potri.012G022100 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.