Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	SAUR22
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G46690 126 / 2e-38 SAUR-like auxin-responsive protein family (.1) AT4G00880 120 / 3e-36 SAUR-like auxin-responsive protein family (.1) AT3G61900 120 / 1e-35 SAUR-like auxin-responsive protein family (.1) AT5G53590 96 / 5e-26 SAUR-like auxin-responsive protein family (.1) AT3G60690 82 / 3e-20 SAUR-like auxin-responsive protein family (.1) AT5G20810 78 / 8e-19 SAUR-like auxin-responsive protein family (.1.2) AT2G45210 77 / 2e-18 SAUR-like auxin-responsive protein family (.1) AT4G12410 75 / 6e-18 SAUR-like auxin-responsive protein family (.1) AT3G43120 74 / 1e-17 SAUR-like auxin-responsive protein family (.1) AT4G22620 74 / 2e-17 SAUR-like auxin-responsive protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G006800 [exp] 163 / 6e-53 AT2G46690 128 / 2e-39 SAUR-like auxin-responsive protein family (.1) Potri.014G103300 [exp] 138 / 4e-43 AT2G46690 152 / 2e-49 SAUR-like auxin-responsive protein family (.1) Potri.002G176400 [exp] 131 / 1e-40 AT2G46690 145 / 2e-46 SAUR-like auxin-responsive protein family (.1) Potri.006G278100 [exp] 83 / 6e-21 AT2G24400 179 / 5e-58 SAUR-like auxin-responsive protein family (.1) Potri.014G066900 [exp] 82 / 1e-20 AT3G60690 191 / 9e-63 SAUR-like auxin-responsive protein family (.1) Potri.002G145300 [exp] 81 / 4e-20 AT3G60690 174 / 4e-56 SAUR-like auxin-responsive protein family (.1) Potri.009G127400 [exp] 75 / 2e-18 AT4G34770 111 / 3e-33 SAUR-like auxin-responsive protein family (.1) Potri.001G060400 [exp] 76 / 1e-17 AT5G50760 71 / 5e-15 SAUR-like auxin-responsive protein family (.1) Potri.019G002201 [exp] 73 / 1e-17 AT5G53590 74 / 8e-18 SAUR-like auxin-responsive protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10010110 [exp] 103 / 4e-29 AT2G46690 124 / 1e-37 SAUR-like auxin-responsive protein family (.1) Lus10032949 [exp] 102 / 2e-28 AT4G00880 104 / 9e-30 SAUR-like auxin-responsive protein family (.1) Lus10008845 [exp] 100 / 7e-28 AT2G46690 102 / 4e-29 SAUR-like auxin-responsive protein family (.1) Lus10030295 [exp] 82 / 1e-20 AT2G45210 131 / 1e-39 SAUR-like auxin-responsive protein family (.1) Lus10009620 [exp] 76 / 5e-19 AT4G38840 112 / 5e-34 SAUR-like auxin-responsive protein family (.1) Lus10009286 [exp] 78 / 8e-19 AT3G60690 150 / 2e-46 SAUR-like auxin-responsive protein family (.1) Lus10026977 [exp] 77 / 2e-18 AT2G24400 184 / 1e-59 SAUR-like auxin-responsive protein family (.1) Lus10015879 [exp] 77 / 3e-18 AT3G60690 151 / 7e-47 SAUR-like auxin-responsive protein family (.1) Lus10007560 [exp] 73 / 1e-17 AT4G34770 139 / 3e-44 SAUR-like auxin-responsive protein family (.1) Lus10025909 [exp] 73 / 2e-17 AT4G34770 116 / 3e-35 SAUR-like auxin-responsive protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02519 [poplar] [flax] Auxin_inducible Auxin responsive protein
Representative CDS sequence Show only first row Show all	>Potri.012G023400.1 pacid=42783376 polypeptide=Potri.012G023400.1.p locus=Potri.012G023400 ID=Potri.012G023400.1.v4.1 annot-version=v4.1 ATGGGGAGTGGAGATAAAAATCATTTGAGTTTTCATATTCACTTGCCAAATCACCATCACCACCACCACCATCATCACCACCACCACCACCACCATGATC ATCATGGCAAGAAGCAGTTGAAAGATATCCCAAAAGGGTGTCTCGCAGTCATGGTAGGGCAAGGTGAGGAGCAACAGAGGTTTGTGATTCCTGTGATTTA TATAAATCACCCGCTGTTCATGCAGTTATTGAAAGAAGCTGAGGAAGAGTTTGGATTTGATCAAGAAGGCCCCATCACTATTCCTTGCCATGTTGAGGAG TTTCGCAATGTTCAAGGCATGATTGAAGAGGAAAAGTCCTCCCAAGATCATCAACAACAACAACACCACCACCACCACCATCACCATCATATCTTGTGCT TTAGGGTTTGA
AA sequence Show only first row Show all	>Potri.012G023400.1 pacid=42783376 polypeptide=Potri.012G023400.1.p locus=Potri.012G023400 ID=Potri.012G023400.1.v4.1 annot-version=v4.1 MGSGDKNHLSFHIHLPNHHHHHHHHHHHHHHHDHHGKKQLKDIPKGCLAVMVGQGEEQQRFVIPVIYINHPLFMQLLKEAEEEFGFDQEGPITIPCHVEE FRNVQGMIEEEKSSQDHQQQQHHHHHHHHHILCFRV

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G46690			SAUR-like auxin-responsive pro...		Potri.012G023400 [exp]	0	1	SAUR22
AT5G13810			Glutaredoxin family protein (....		Potri.001G026600 [exp]	1.41	0.7687
AT1G12760			Zinc finger, C3HC4 type (RING ...		Potri.003G123300 [exp]	7.07	0.7347
AT5G01990			Auxin efflux carrier family pr...		Potri.016G141700 [exp]	11.13	0.7356
AT1G08315			ARM repeat superfamily protein...		Potri.003G195400 [exp]	12.12	0.7240
					Potri.017G055050 [exp]	12.80	0.7453
AT4G36870	HD	BLH2, SAW1	SAWTOOTH 1, BEL1-like homeodom...		Potri.005G129500 [exp]	16.88	0.6711
AT2G41690	HSF	AT-HSFB3, HSFB3	HEAT SHOCK TRANSCRIPTION FACTO...		Potri.016G056500 [exp]	18.70	0.6820	HSFB3.2
AT4G28500	NAC	ANAC073, SND2, ...	SECONDARY WALL-ASSOCIATED NAC ...		Potri.011G058400 [exp]	23.10	0.7344
AT5G58190		ECT10	evolutionarily conserved C-ter...		Potri.018G149800 [exp]	26.98	0.6852
AT2G17030			F-box family protein with a do...		Potri.004G179685 [exp]	27.98	0.6546

Compare expression of checked genes

Potri.012G023400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.