Potri.012G023450 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G53588 44 / 2e-08 CPuORF50 conserved peptide upstream open reading frame 50 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G006850 61 / 4e-15 AT5G53588 42 / 8e-08 conserved peptide upstream open reading frame 50 (.1)
Potri.002G145251 44 / 2e-08 AT5G53588 38 / 5e-06 conserved peptide upstream open reading frame 50 (.1)
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G023450.1 pacid=42783892 polypeptide=Potri.012G023450.1.p locus=Potri.012G023450 ID=Potri.012G023450.1.v4.1 annot-version=v4.1
ATGAGCAATATACCAAGATCTCTTGCAGACTCTTCTTTCACCCTTTTCAAGCTTGCCATTTCTGCAGCTGATCCTTGGCCTTTCTCTCTTGTTTTCTTAT
AA
AA sequence
>Potri.012G023450.1 pacid=42783892 polypeptide=Potri.012G023450.1.p locus=Potri.012G023450 ID=Potri.012G023450.1.v4.1 annot-version=v4.1
MSNIPRSLADSSFTLFKLAISAADPWPFSLVFL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G53588 CPuORF50 conserved peptide upstream ope... Potri.012G023450 0 1
AT5G59810 ATSBT5.4 Subtilase family protein (.1) Potri.001G468900 4.00 0.8160
Potri.012G022650 4.89 0.7927
AT1G43760 DNAse I-like superfamily prote... Potri.004G128880 6.70 0.6673
AT1G30760 FAD-binding Berberine family p... Potri.011G161500 21.44 0.7598
AT1G57680 unknown protein Potri.012G023500 23.91 0.6915
AT1G57775 Protein of unknown function (D... Potri.004G115251 24.65 0.6233
AT1G57775 Protein of unknown function (D... Potri.004G115351 25.03 0.6233
Potri.010G033266 25.41 0.6233
AT1G57775 Protein of unknown function (D... Potri.004G109600 28.42 0.5230
AT1G57775 Protein of unknown function (D... Potri.004G110926 31.11 0.5378

Potri.012G023450 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.