Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17260 89 / 8e-21 NAC ANAC086 NAC domain containing protein 86 (.1) AT3G03200 86 / 8e-20 NAC ANAC045 NAC domain containing protein 45 (.1) AT2G33480 82 / 4e-19 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT3G17730 81 / 5e-19 NAC ANAC057 NAC domain containing protein 57 (.1) AT5G46590 81 / 9e-19 NAC ANAC096 NAC domain containing protein 96 (.1) AT1G65910 82 / 1e-18 NAC ANAC028 NAC domain containing protein 28 (.1) AT1G77450 81 / 1e-18 NAC ANAC032 NAC domain containing protein 32 (.1) AT5G09330 82 / 2e-18 NAC VNI1, ANAC082 VND-interacting 1, NAC domain containing protein 82 (.1.2.3.4) AT1G34180 81 / 3e-18 NAC ANAC016 NAC domain containing protein 16 (.1.2) AT4G27410 80 / 3e-18 NAC RD26, ANAC072 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G024200 [exp] 318 / 4e-113 AT5G17260 97 / 5e-24 NAC domain containing protein 86 (.1) Potri.012G024100 [exp] 295 / 5e-104 AT5G17260 90 / 2e-21 NAC domain containing protein 86 (.1) Potri.015G007000 [exp] 266 / 2e-92 AT2G33480 100 / 4e-26 NAC domain containing protein 41 (.1.2) Potri.004G119400 [exp] 245 / 4e-84 AT1G69490 88 / 2e-21 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.009G052300 [exp] 94 / 3e-23 AT1G01720 179 / 2e-53 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.010G229900 [exp] 87 / 2e-20 AT5G04410 481 / 4e-165 Arabidopsis NAC domain containing protein 78, NAC domain containing protein 2 (.1) Potri.001G061200 [exp] 85 / 2e-20 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.009G052200 [exp] 84 / 2e-19 AT4G27410 188 / 1e-55 NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.2), NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.3) Potri.010G166200 [exp] 82 / 4e-19 AT1G69490 305 / 1e-104 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10020896 [exp] 86 / 6e-20 AT5G09330 276 / 2e-88 VND-interacting 1, NAC domain containing protein 82 (.1.2.3.4) Lus10001809 [exp] 83 / 2e-19 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10026373 [exp] 80 / 3e-18 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1) Lus10042284 [exp] 80 / 3e-18 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10002581 [exp] 79 / 6e-18 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10028713 [exp] 81 / 7e-18 AT1G34190 392 / 2e-130 NAC domain containing protein 17 (.1) Lus10033493 [exp] 79 / 8e-18 AT5G08790 315 / 4e-108 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10027357 [exp] 80 / 9e-18 AT3G04070 172 / 3e-50 NAC domain containing protein 47 (.1.2) Lus10032657 [exp] 79 / 1e-17 AT3G15510 353 / 1e-120 NAC-REGULATED SEED MORPHOLOGY 1, Arabidopsis NAC domain containing protein 56, NAC domain containing protein 2 (.1) Lus10020883 [exp] 79 / 1e-17 AT5G08790 320 / 6e-110 Arabidopsis NAC domain containing protein 81, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.012G023900.1 pacid=42784222 polypeptide=Potri.012G023900.1.p locus=Potri.012G023900 ID=Potri.012G023900.1.v4.1 annot-version=v4.1 ATGGCTAGCGGCGGACAAGCTTTGAACGTGCCAGTTCTCCTTGCTGGCTACAAATTTAGCCCTGATAATGATGATCTTATTGTTTATTATTTGAAGAGAA AAATTCTGGGCCAACAACTTCCTGCTGATGTTATTACCACCACTGATGTATATGCATCAAGCCCTGATAAACTCCCCTTGGATGATTTTAAGGGCGGGGT GCCCAACGAGTGGTTTTTCTTTTCAACTAGAAGCAAGGATGATAACATTATTGCACTAGATGGTGGCTACTATGCAATCGATCCCGAAGGTGCTGGCCCG ATCACATGGGAGGGAAAAGTTGTTGGTTATGTAAAGACTCTGAATTTCTATCAAGGAAGCTCACCTAATGGAACTGAAACTGAATGGATGGTAGAGGAGT TCAGAGTCAATCCTGAGTTTGTTCCAATTAACAACAACGACCGTAGCACTCGAGAAAAGATAGAAAACCTTGTTGCATGCAAAATTTCTCGAGTGCAACC TGAACCTGAATGGTAG
AA sequence Show only first row Show all	>Potri.012G023900.1 pacid=42784222 polypeptide=Potri.012G023900.1.p locus=Potri.012G023900 ID=Potri.012G023900.1.v4.1 annot-version=v4.1 MASGGQALNVPVLLAGYKFSPDNDDLIVYYLKRKILGQQLPADVITTTDVYASSPDKLPLDDFKGGVPNEWFFFSTRSKDDNIIALDGGYYAIDPEGAGP ITWEGKVVGYVKTLNFYQGSSPNGTETEWMVEEFRVNPEFVPINNNDRSTREKIENLVACKISRVQPEPEW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G17260	NAC	ANAC086	NAC domain containing protein ...		Potri.012G023900 [exp]	0	1
AT5G08391			Protein of unknown function (D...		Potri.017G064301 [exp]	3.46	0.9232
AT4G19645			TRAM, LAG1 and CLN8 (TLC) lipi...		Potri.002G056600 [exp]	3.87	0.9058
					Potri.009G092750 [exp]	5.65	0.8837
AT1G24190		SNL3, AtSin3	ARABIDOPSIS THALIANA SIN3 HOMO...		Potri.017G056201 [exp]	5.65	0.9062
AT3G55530		SDIR1	SALT- AND DROUGHT-INDUCED RING...		Potri.010G201500 [exp]	5.74	0.8756
					Potri.008G195401 [exp]	8.06	0.8667
AT4G17070			peptidyl-prolyl cis-trans isom...		Potri.002G139600 [exp]	10.09	0.8516
AT4G01840		KCO5, ATTPK5, A...	Ca2+ activated outward rectify...		Potri.002G187600 [exp]	10.58	0.8666	Pt-KCO5.2
AT2G24640		UBP19	ubiquitin-specific protease 19...		Potri.018G009500 [exp]	12.32	0.8493
AT2G16980			Major facilitator superfamily ...		Potri.010G237300 [exp]	13.96	0.8173

Compare expression of checked genes

Potri.012G023900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.