Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G17260 97 / 5e-24 NAC ANAC086 NAC domain containing protein 86 (.1) AT5G46590 91 / 2e-22 NAC ANAC096 NAC domain containing protein 96 (.1) AT3G17730 89 / 4e-22 NAC ANAC057 NAC domain containing protein 57 (.1) AT1G65910 92 / 8e-22 NAC ANAC028 NAC domain containing protein 28 (.1) AT3G03200 91 / 1e-21 NAC ANAC045 NAC domain containing protein 45 (.1) AT2G33480 87 / 4e-21 NAC ANAC041 NAC domain containing protein 41 (.1.2) AT1G69490 87 / 6e-21 NAC NAP, ANAC029, ATNAP Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) AT4G17980 86 / 1e-20 NAC ANAC071 NAC domain containing protein 71 (.1) AT5G13180 85 / 2e-20 NAC VNDIP2, ANAC083, VNI2 VND-interacting 2, NAC domain containing protein 83 (.1) AT3G04070 85 / 9e-20 NAC ANAC047 NAC domain containing protein 47 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G023900 [exp] 318 / 4e-113 AT5G17260 89 / 7e-21 NAC domain containing protein 86 (.1) Potri.012G024100 [exp] 286 / 1e-100 AT5G17260 90 / 2e-21 NAC domain containing protein 86 (.1) Potri.015G007000 [exp] 264 / 2e-91 AT2G33480 100 / 4e-26 NAC domain containing protein 41 (.1.2) Potri.004G119400 [exp] 244 / 5e-84 AT1G69490 88 / 2e-21 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Potri.009G052300 [exp] 97 / 3e-24 AT1G01720 179 / 2e-53 Arabidopsis NAC domain containing protein 2, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.001G061200 [exp] 91 / 1e-22 AT5G13180 310 / 6e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.003G166500 [exp] 88 / 1e-21 AT5G13180 310 / 4e-107 VND-interacting 2, NAC domain containing protein 83 (.1) Potri.017G139500 [exp] 90 / 4e-21 AT1G65910 461 / 1e-154 NAC domain containing protein 28 (.1) Potri.010G174600 [exp] 88 / 4e-21 AT1G54330 290 / 2e-97 NAC domain containing protein 20 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042284 [exp] 88 / 3e-21 AT3G17730 348 / 1e-121 NAC domain containing protein 57 (.1) Lus10026373 [exp] 88 / 3e-21 AT3G17730 348 / 2e-121 NAC domain containing protein 57 (.1) Lus10001809 [exp] 87 / 3e-21 AT5G13180 271 / 6e-92 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10010959 [exp] 86 / 9e-20 AT1G65910 389 / 9e-128 NAC domain containing protein 28 (.1) Lus10020794 [exp] 86 / 1e-19 AT5G10360 449 / 8e-153 Ribosomal protein small subunit 6b, embryo defective 3010, Ribosomal protein S6e (.1.2) Lus10007377 [exp] 85 / 1e-19 AT1G65910 431 / 7e-143 NAC domain containing protein 28 (.1) Lus10037156 [exp] 84 / 1e-19 AT1G69490 318 / 2e-109 Arabidopsis NAC domain containing protein 29, NAC-like, activated by AP3/PI (.1) Lus10002581 [exp] 83 / 1e-19 AT5G13180 273 / 6e-93 VND-interacting 2, NAC domain containing protein 83 (.1) Lus10032238 [exp] 84 / 2e-19 AT1G12260 432 / 6e-151 VASCULAR RELATED NAC-DOMAIN PROTEIN 4, EMBRYO DEFECTIVE 2749, NAC 007 (.1) Lus10035373 [exp] 84 / 2e-19 AT4G17980 280 / 2e-93 NAC domain containing protein 71 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.012G024200.3 pacid=42782741 polypeptide=Potri.012G024200.3.p locus=Potri.012G024200 ID=Potri.012G024200.3.v4.1 annot-version=v4.1 ATGGCTAGCGCAGGACAAGCTTTGAACCGGCCAACTCTCCCTGCTGGCTACAGATTTAGCCCTAACAATGATGATCTTATTGTTTATTATTTGAAGAGAA AAATTCTGGGCCAACAACTTCCTGCTGATGTTATTCCCACCACTGATGTTTATGCATCAAGCCCTGATAAACTCCCCTTAGATGATTTTAAAGGCGGGGA GGCAAACGAGTGGTTTTTCTTTTCAAATAGAAGCAAGGATGATGACACTATTGCACTGGATGGTGGCTACTATGCAATCGATCCCGAAGGTGCTGGCCCG ATCACATGGGAGGGAAAAATTGTTGGTTATGTGAAGACTCTGAATTTCTATCAAGGAAGCTTACCTAATGGAACTGAAACTGAATGGATGGTAGAGGAGT TCAGAATCAATCCTGAGTTTGTTCCAATTAACAACAACGACGACCGTAGCACTCGAGAAAAGATTGAAAACCTTGTTGCATGCAAAATTTCTCGAGTGCA ACCTGAACCTGAATGGTAG
AA sequence Show only first row Show all	>Potri.012G024200.3 pacid=42782741 polypeptide=Potri.012G024200.3.p locus=Potri.012G024200 ID=Potri.012G024200.3.v4.1 annot-version=v4.1 MASAGQALNRPTLPAGYRFSPNNDDLIVYYLKRKILGQQLPADVIPTTDVYASSPDKLPLDDFKGGEANEWFFFSNRSKDDDTIALDGGYYAIDPEGAGP ITWEGKIVGYVKTLNFYQGSLPNGTETEWMVEEFRINPEFVPINNNDDRSTREKIENLVACKISRVQPEPEW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G17260	NAC	ANAC086	NAC domain containing protein ...		Potri.012G024200 [exp]	0	1
AT1G28300	B3	LEC2	LEAFY COTYLEDON 2, AP2/B3-like...		Potri.004G045800 [exp]	7.93	0.8963
AT5G58610			PHD finger transcription facto...		Potri.002G118600 [exp]	28.19	0.7194
AT2G05920			Subtilase family protein (.1)		Potri.001G113533 [exp]	29.39	0.8857
AT3G04280		ARR22	response regulator 22 (.1.2.3)		Potri.003G177300 [exp]	30.59	0.8857
AT1G32583			unknown protein		Potri.010G145501 [exp]	34.98	0.8857
					Potri.014G045150 [exp]	37.94	0.8857
AT2G19170		SLP3	subtilisin-like serine proteas...		Potri.001G151100 [exp]	40.39	0.8195
					Potri.019G036825 [exp]	40.69	0.8857
AT3G58610			ketol-acid reductoisomerase (....		Potri.019G089366 [exp]	41.56	0.8857
AT2G24350			RNA binding (RRM/RBD/RNP motif...		Potri.012G145100 [exp]	41.64	0.8538

Compare expression of checked genes

Potri.012G024200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.