Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G45616 62 / 2e-12 AtRLP6 receptor like protein 6 (.1) AT1G71400 61 / 4e-12 AtRLP12 receptor like protein 12 (.1) AT3G05360 61 / 4e-12 AtRLP30 receptor like protein 30 (.1) AT3G05650 57 / 5e-11 AtRLP32 receptor like protein 32 (.1) AT1G47890 57 / 1e-10 AtRLP7 receptor like protein 7 (.1) AT1G71390 56 / 3e-10 AtRLP11 receptor like protein 11 (.1) AT3G05660 55 / 3e-10 AtRLP33 receptor like protein 33 (.1) AT2G15080 55 / 4e-10 AtRLP19 receptor like protein 19 (.1.2) AT3G11080 55 / 4e-10 AtRLP35 receptor like protein 35 (.1) AT3G23110 53 / 2e-09 EMB2800, AtRLP37 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G014625 [exp] 114 / 6e-31 AT3G05660 366 / 4e-112 receptor like protein 33 (.1) Potri.012G027400 [exp] 113 / 9e-31 AT3G05660 347 / 3e-105 receptor like protein 33 (.1) Potri.012G010101 [exp] 111 / 4e-30 AT1G45616 379 / 6e-115 receptor like protein 6 (.1) Potri.012G030125 [exp] 111 / 6e-30 AT2G33060 330 / 2e-100 receptor like protein 27 (.1) Potri.012G008300 [exp] 111 / 6e-30 AT2G33060 332 / 5e-101 receptor like protein 27 (.1) Potri.011G055000 [exp] 111 / 7e-30 AT1G45616 456 / 3e-145 receptor like protein 6 (.1) Potri.012G026900 [exp] 110 / 1e-29 AT3G25010 315 / 2e-93 receptor like protein 41 (.1) Potri.012G013435 [exp] 106 / 4e-28 AT3G11080 367 / 6e-112 receptor like protein 35 (.1) Potri.010G009400 [exp] 105 / 4e-28 AT2G33060 209 / 3e-58 receptor like protein 27 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10024721 [exp] 60 / 1e-11 AT3G23110 369 / 1e-114 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1) Lus10027580 [exp] 54 / 9e-10 AT5G62230 194 / 4e-53 ERECTA-like 1 (.1.2) Lus10019692 [exp] 47 / 1e-07 AT3G05370 82 / 8e-19 receptor like protein 31 (.1) Lus10014905 [exp] 47 / 3e-07 AT1G47890 240 / 4e-70 receptor like protein 7 (.1) Lus10014910 [exp] 47 / 4e-07 AT1G71400 357 / 7e-110 receptor like protein 12 (.1) Lus10032335 [exp] 46 / 7e-07 AT3G23110 372 / 7e-116 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1) Lus10011039 [exp] 45 / 1e-06 AT3G11010 367 / 5e-110 receptor like protein 34 (.1) Lus10042239 [exp] 44 / 4e-06 AT1G45616 395 / 1e-121 receptor like protein 6 (.1) Lus10002753 [exp] 40 / 5e-05 AT2G34930 389 / 2e-120 disease resistance family protein / LRR family protein (.1) Lus10006824 [exp] 40 / 7e-05 AT3G23110 185 / 2e-50 EMBRYO DEFECTIVE 2800, receptor like protein 37 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF08263 [poplar] [flax] LRRNT_2 Leucine rich repeat N-terminal domain
Representative CDS sequence Show only first row Show all	>Potri.012G024900.1 pacid=42782733 polypeptide=Potri.012G024900.1.p locus=Potri.012G024900 ID=Potri.012G024900.1.v4.1 annot-version=v4.1 ATGGGGTTTTCACCACCGTCCCTCTCTTTCATTCTGTTTCTCTTCCATTTCCTTTCAACAATTTCTTCATCTCATTTTTGTGCTCATGACCAAAATCTTT CTTTGCTCCAATTCAAAGAATCCTTTTCCATTAATAGCTCTGCTTCATGGAATTGCCAGCATCCCAAGACACAGTCGTGGAAAGAGGGTACAGATTGCTG CTTGTGGGATGGGGTGACCTGTGGAATGAAATCCGGTCATGTAACTGGGCTTAACCTTGCTTGGATTCAGGTGCAGAAAAGAATGTAA
AA sequence Show only first row Show all	>Potri.012G024900.1 pacid=42782733 polypeptide=Potri.012G024900.1.p locus=Potri.012G024900 ID=Potri.012G024900.1.v4.1 annot-version=v4.1 MGFSPPSLSFILFLFHFLSTISSSHFCAHDQNLSLLQFKESFSINSSASWNCQHPKTQSWKEGTDCCLWDGVTCGMKSGHVTGLNLAWIQVQKRM

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G45616		AtRLP6	receptor like protein 6 (.1)		Potri.012G024900 [exp]	0	1
AT5G06060			NAD(P)-binding Rossmann-fold s...		Potri.010G199700 [exp]	7.74	0.8754
AT3G22425		HISN5A, IGPD	imidazoleglycerol-phosphate de...		Potri.008G152701 [exp]	11.22	0.8774
AT4G03090			sequence-specific DNA binding;...		Potri.002G213400 [exp]	12.36	0.8578
AT1G70650			Ran BP2/NZF zinc finger-like s...		Potri.010G107400 [exp]	12.44	0.8315
AT1G55250		HUB2, HISTONEMO...	histone mono-ubiquitination 2 ...		Potri.003G216651 [exp]	16.43	0.8841
AT1G62930		RPF3	RNA processing factor 3, Tetra...		Potri.006G271200 [exp]	19.87	0.8483
AT3G62330			Zinc knuckle (CCHC-type) famil...		Potri.002G192800 [exp]	22.62	0.8351
AT2G28490			RmlC-like cupins superfamily p...		Potri.009G054700 [exp]	27.23	0.8791
AT5G16990			Zinc-binding dehydrogenase fam...		Potri.017G002600 [exp]	28.82	0.8860
AT2G33600			NAD(P)-binding Rossmann-fold s...		Potri.002G003200 [exp]	46.33	0.8384

Compare expression of checked genes

Potri.012G024900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.