Potri.012G027700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG01120 137 / 7e-44 ATCG01120.1, RPS15 chloroplast ribosomal protein S15 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0600 S15_NS1 PF00312 Ribosomal_S15 Ribosomal protein S15
Representative CDS sequence
>Potri.012G027700.1 pacid=42783104 polypeptide=Potri.012G027700.1.p locus=Potri.012G027700 ID=Potri.012G027700.1.v4.1 annot-version=v4.1
ATGGTAAAAAGTTCATTCATTTCAATTATTTCACAAGAAAACAAAAAAGAAAACAAGGGATCGGTTGAATTTCAAATAGTAAGTTTTACTAATAAGATAC
GAAGACTTACTTCACATTTGGAATTACATAGAAAAGACTATTTATCTCAAAGAGGTTTACGGAAAATTCTAGGAAAACGCCAACGACTACTGTCTTATTT
GGCAAAGAAAAATGGAGTACGTTATAAAGAATTAATTAGCCAGTTGAACATTCGGGAATCAAAAACTCGTTAA
AA sequence
>Potri.012G027700.1 pacid=42783104 polypeptide=Potri.012G027700.1.p locus=Potri.012G027700 ID=Potri.012G027700.1.v4.1 annot-version=v4.1
MVKSSFISIISQENKKENKGSVEFQIVSFTNKIRRLTSHLELHRKDYLSQRGLRKILGKRQRLLSYLAKKNGVRYKELISQLNIRESKTR

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG01120 ATCG01120.1, RP... chloroplast ribosomal protein ... Potri.012G027700 0 1
ATCG01110 ATCG01110.1, ND... NAD(P)H dehydrogenase subunit ... Potri.013G074650 3.00 0.9837
ATCG00420 ATCG00420.1, ND... NADH dehydrogenase subunit J (... Potri.013G163200 9.79 0.9641
ATCG00170 ATCG00170.1, RP... DNA-directed RNA polymerase fa... Potri.013G140260 11.66 0.9762
ATCG00160 ATCG00160.1, RP... ribosomal protein S2 (.1) Potri.019G028700 12.36 0.9723
AT5G19640 Major facilitator superfamily ... Potri.003G212900 13.34 0.9267
ATCG00160 ATCG00160.1, RP... ribosomal protein S2 (.1) Potri.013G139670 14.07 0.9716
ATCG00710 ATCG00710.1, PS... photosystem II reaction center... Potri.019G028200 16.12 0.9650
ATCG01100 ATCG01100.1, ND... NADH dehydrogenase family prot... Potri.013G074800 19.44 0.9596
ATCG00130 ATCG00130.1, AT... ATPase, F0 complex, subunit B/... Potri.013G137900 20.19 0.9584
ATCG00190 ATCG00190.1, RP... RNA polymerase subunit beta (.... Potri.013G142232 23.47 0.9608

Potri.012G027700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.