Potri.012G030301 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G030301.1 pacid=42782962 polypeptide=Potri.012G030301.1.p locus=Potri.012G030301 ID=Potri.012G030301.1.v4.1 annot-version=v4.1
ATGGAAAGGAGCAGGGCATGGGAATCGAAGCATTGGAAGCCATGCTTATGGATGATGAATTTAGAGGATTTTCAAGGTCCAAGAGTTTACTTGACTGAGA
TCTCAGACTTGTTGATTATGGCATGGACTATTCAGGACAGAAATAGCAGACCATGCCTTCAGGCAATTCTGAGCTTTTTTTGTTTTCCAACAGAAAAGAT
AGCAAACAAGATCTGTGGCTGCTGTTGCACCGGGTCATCCATTCCTTTTCTTTCTGAGATTCATGTTGACAGATTGTACAATCAAACTCTAAATGCTTTA
TTCAGTATCTCACAGCCAAGATTAAAGTCTGCTTTGTGCCCGGTCCATTGA
AA sequence
>Potri.012G030301.1 pacid=42782962 polypeptide=Potri.012G030301.1.p locus=Potri.012G030301 ID=Potri.012G030301.1.v4.1 annot-version=v4.1
MERSRAWESKHWKPCLWMMNLEDFQGPRVYLTEISDLLIMAWTIQDRNSRPCLQAILSFFCFPTEKIANKICGCCCTGSSIPFLSEIHVDRLYNQTLNAL
FSISQPRLKSALCPVH

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G030301 0 1
AT5G04760 MYB Duplicated homeodomain-like su... Potri.008G016175 4.89 0.8677
AT5G36930 Disease resistance protein (TI... Potri.003G014200 7.48 0.8620
AT2G33860 ARF ARF3, ETT ETTIN, AUXIN RESPONSE TRANSCRI... Potri.011G059101 10.48 0.8705
Potri.011G012201 11.48 0.8492
AT5G46070 Guanylate-binding family prote... Potri.017G016800 15.29 0.8479
AT2G39910 ARM repeat superfamily protein... Potri.008G063500 18.05 0.7715
AT3G01930 Major facilitator superfamily ... Potri.017G064201 18.33 0.8468
AT1G05430 unknown protein Potri.008G154200 19.89 0.8110
AT1G63350 Disease resistance protein (CC... Potri.018G145534 24.43 0.7621
AT1G63690 ATSPPL2 SIGNAL PEPTIDE PEPTIDASE-LIKE ... Potri.001G103100 25.74 0.8530

Potri.012G030301 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.