Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G61640 65 / 5e-16 AGP20, ATAGP20 arabinogalactan protein 20 (.1) AT5G53250 63 / 4e-15 AGP22, ATAGP22 arabinogalactan protein 22 (.1) AT2G46330 63 / 4e-15 ATAGP16, AGP16 arabinogalactan protein 16 (.1.2) AT5G24105 49 / 2e-09 AGP41 arabinogalactan protein 41 (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G022600 [exp] 95 / 9e-28 AT5G53250 70 / 4e-18 arabinogalactan protein 22 (.1) Potri.014G094800 [exp] 51 / 2e-10 AT3G61640 42 / 1e-06 arabinogalactan protein 20 (.1) Potri.018G078801 [exp] 51 / 2e-10 ND / Potri.001G094700 [exp] 48 / 4e-09 AT2G46330 57 / 7e-13 arabinogalactan protein 16 (.1.2) Potri.003G136600 [exp] 45 / 7e-08 AT5G53250 55 / 7e-12 arabinogalactan protein 22 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10037436 [exp] 50 / 5e-10 AT5G53250 51 / 2e-10 arabinogalactan protein 22 (.1) Lus10000542 [exp] 47 / 1e-08 AT2G46330 63 / 6e-15 arabinogalactan protein 16 (.1.2) Lus10024263 [exp] 45 / 4e-08 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10023629 [exp] 45 / 4e-08 AT2G46330 51 / 2e-10 arabinogalactan protein 16 (.1.2) Lus10032355 [exp] 45 / 2e-07 AT3G61640 60 / 9e-13 arabinogalactan protein 20 (.1) Lus10033939 [exp] 45 / 3e-07 AT3G61640 61 / 4e-13 arabinogalactan protein 20 (.1) Lus10041273 [exp] 37 / 0.0001 AT3G61640 51 / 3e-10 arabinogalactan protein 20 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF06376 [poplar] [flax] AGP Arabinogalactan peptide
Representative CDS sequence Show only first row Show all	>Potri.012G032000.1 pacid=42783847 polypeptide=Potri.012G032000.1.p locus=Potri.012G032000 ID=Potri.012G032000.1.v4.1 annot-version=v4.1 ATGGCTGTTTCAAACATTTCATTTGGAGTTTTTGCTGCCATTGTTGCCATTATTTTTGCCATCTCCATGCCTTTGGCTCATGGCCAATCTTCAGCTCCTG CTCCATCACCCACAAGCGATGGCGCTGCAATAGACCAAGGAGTAGCTTGTATTCTAATGCTTGTGGCGTTGGTGCTCACATACCTTATTCACTGA
AA sequence Show only first row Show all	>Potri.012G032000.1 pacid=42783847 polypeptide=Potri.012G032000.1.p locus=Potri.012G032000 ID=Potri.012G032000.1.v4.1 annot-version=v4.1 MAVSNISFGVFAAIVAIIFAISMPLAHGQSSAPAPSPTSDGAAIDQGVACILMLVALVLTYLIH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G61640		AGP20, ATAGP20	arabinogalactan protein 20 (.1...		Potri.012G032000 [exp]	0	1
AT2G42410	C2H2ZnF	ATZFP11, ZFP11	zinc finger protein 11 (.1)		Potri.002G041700 [exp]	3.00	0.7857
AT2G07180			Protein kinase superfamily pro...		Potri.006G079600 [exp]	4.89	0.7716
					Potri.001G055675 [exp]	7.74	0.7124
					Potri.001G121350 [exp]	10.39	0.7499
AT1G68330			unknown protein		Potri.010G122800 [exp]	12.72	0.6730
AT2G01050			zinc ion binding;nucleic acid ...		Potri.017G002800 [exp]	13.52	0.5851
AT2G21385			unknown protein		Potri.009G121902 [exp]	13.96	0.7010
AT1G70140		ATFH8	formin 8 (.1)		Potri.015G069800 [exp]	15.81	0.6585
AT5G01075			Glycosyl hydrolase family 35 p...		Potri.014G017600 [exp]	17.66	0.6952
AT1G51630			O-fucosyltransferase family pr...		Potri.008G008300 [exp]	28.00	0.6522

Compare expression of checked genes

Potri.012G032000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.