Potri.012G033700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G52960 203 / 9e-68 unknown protein
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.016G123100 253 / 2e-87 AT5G52960 167 / 6e-54 unknown protein
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10039319 184 / 5e-60 AT5G52960 185 / 1e-60 unknown protein
Lus10027566 184 / 7e-60 AT5G52960 184 / 3e-60 unknown protein
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF11341 DUF3143 Protein of unknown function (DUF3143)
Representative CDS sequence
>Potri.012G033700.1 pacid=42784163 polypeptide=Potri.012G033700.1.p locus=Potri.012G033700 ID=Potri.012G033700.1.v4.1 annot-version=v4.1
ATGCCCACCATTTCTTCCATACTTACTACCACTAACATCCTCCTTTCTTCACACCCTTCAACTTCCACTCATCCTTCCAAAGTCTCTTACTTTCCCTCAT
TGCACCCTCCCCTTTTCTCCAAATCTCTTTCATGTCCTTATCCTCTATGTAAGTTTTTAAGAAACCCCAAGAGAATAATTTCTTTAAAATCATCTGAAGC
AGAGGAGATATCTTCAACAGAAGATGAGTGGCTACAAAGACTCCCTGACAAGAAAAAGCCTCTGTACTCTCATAGCTTACCTTGCATTGAAGCTTGGTTG
AAGGATTTGGGGTTTTATCAAAGCAAGGAGGACCGTGCTATTTGGTTTATTGAGAAACCTGATTGGCATGCTCAGTTGTCACTTGATGTCACTGATCTTT
TTATAAGGTACTTGAAGAATGGACCAGGGAATCTTGAAAAGGATATGGAGAGGAGATTCAGTTACGCACTGAGTAGAGAAGATATAGAAAATGCCATTCT
TGGAGGACCATAG
AA sequence
>Potri.012G033700.1 pacid=42784163 polypeptide=Potri.012G033700.1.p locus=Potri.012G033700 ID=Potri.012G033700.1.v4.1 annot-version=v4.1
MPTISSILTTTNILLSSHPSTSTHPSKVSYFPSLHPPLFSKSLSCPYPLCKFLRNPKRIISLKSSEAEEISSTEDEWLQRLPDKKKPLYSHSLPCIEAWL
KDLGFYQSKEDRAIWFIEKPDWHAQLSLDVTDLFIRYLKNGPGNLEKDMERRFSYALSREDIENAILGGP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G52960 unknown protein Potri.012G033700 0 1
AT3G54210 Ribosomal protein L17 family p... Potri.016G143100 2.23 0.9839
AT2G01870 unknown protein Potri.001G257400 3.00 0.9834
AT2G47450 CPSRP43, CAO CHLOROPLAST SIGNAL RECOGNITION... Potri.009G140500 3.74 0.9778 Pt-CAO.3
AT3G54210 Ribosomal protein L17 family p... Potri.006G113500 3.74 0.9838
AT1G76080 ATCDSP32, CDSP3... ARABIDOPSIS THALIANA CHLOROPLA... Potri.002G016401 5.65 0.9774
AT1G68590 Ribosomal protein PSRP-3/Ycf65... Potri.010G127300 5.91 0.9792
AT3G61870 unknown protein Potri.014G102400 6.00 0.9821
AT1G23740 AOR alkenal/one oxidoreductase, Ox... Potri.016G136100 7.21 0.9744
AT3G15190 chloroplast 30S ribosomal prot... Potri.001G396600 7.34 0.9778
AT3G26630 Tetratricopeptide repeat (TPR)... Potri.002G220600 7.93 0.9701

Potri.012G033700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.