Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G73530 142 / 3e-43 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G54580 99 / 1e-26 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G20930 95 / 2e-23 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G46020 87 / 1e-22 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT5G06210 88 / 2e-22 RNA binding (RRM/RBD/RNP motifs) family protein (.1) AT2G27330 83 / 6e-21 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT2G37510 82 / 4e-20 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) AT3G23830 74 / 4e-17 AtGRP4, GR-RBP4, GRP4 glycine-rich RNA-binding protein 4 (.1.2) AT4G13850 74 / 5e-17 ATGRP2, GR-RBP2 glycine rich protein 2, glycine-rich RNA-binding protein 2 (.1.2.3.4) AT5G59860 73 / 1e-16 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.008G022280 [exp] 94 / 7e-25 AT3G20930 203 / 2e-65 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.006G208500 [exp] 92 / 5e-24 AT5G06210 160 / 1e-51 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G409800 [exp] 92 / 6e-24 AT5G54580 174 / 2e-56 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.010G237200 [exp] 97 / 7e-24 AT3G20930 429 / 5e-150 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.011G130300 [exp] 91 / 1e-23 AT5G54580 161 / 2e-51 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.008G022200 [exp] 94 / 5e-23 AT3G20930 427 / 3e-149 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.009G160300 [exp] 86 / 4e-22 AT2G27330 98 / 1e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Potri.001G207100 [exp] 75 / 1e-16 AT3G26420 175 / 7e-55 RZ-1A, RNA-binding (RRM/RBD/RNP motifs) family protein with retrovirus zinc finger-like domain (.1) Potri.003G074900 [exp] 74 / 1e-16 AT4G20030 164 / 2e-52 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026364 [exp] 120 / 4e-35 AT1G73530 112 / 6e-32 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10042293 [exp] 110 / 6e-31 AT1G73530 100 / 7e-27 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003593 [exp] 98 / 2e-24 AT5G54580 174 / 6e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10014802 [exp] 98 / 2e-24 AT5G54580 176 / 2e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10023758 [exp] 89 / 2e-22 AT2G37510 164 / 9e-53 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10003980 [exp] 87 / 4e-22 AT2G37510 169 / 1e-54 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10027035 [exp] 92 / 5e-22 AT3G20930 360 / 8e-123 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10013306 [exp] 80 / 2e-19 AT5G06210 94 / 3e-25 RNA binding (RRM/RBD/RNP motifs) family protein (.1) Lus10040854 [exp] 77 / 7e-19 AT3G46020 112 / 1e-33 RNA-binding (RRM/RBD/RNP motifs) family protein (.1) Lus10025573 [exp] 82 / 3e-18 AT3G20930 336 / 3e-109 RNA-binding (RRM/RBD/RNP motifs) family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0221 [poplar] [flax] RRM PF00076 [poplar] [flax] RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Representative CDS sequence Show only first row Show all	>Potri.012G038200.3 pacid=42783076 polypeptide=Potri.012G038200.3.p locus=Potri.012G038200 ID=Potri.012G038200.3.v4.1 annot-version=v4.1 ATGGCAACAGCAAGCACAATCTTCAGCTTCAAAATCGCACCAAATCCAAGTCCAGTTTCATCCTTTAAAGAGAAAACCATGATAATGAACCCATCTCTTT CATGGGATAGTGCTAAAACTAAGGTTAGAAGAAGCCGTTTCCCTTACTTCACCTTAAACTATATTGAAAGACAAAGACTTGAAAACAGTTGCAGCTGTTG CTCAGTCTTGGCTTGTCTCCCTTCTTCAGCTTCTTCTCCTTCCTCTTTTGGTTTCAACTTCAGAAAAACCAAGCTTTATGTCAGTGGGTTATCCTTTCGT ACTACTGAAGAGAGTTTGCGAAATGCTTTCCAGAATTTTGGCCAACTTGTAGATGTCAATTTGGTAATGGATAAAGTAGCTAAAAGACCGAGAGGCTTTG CCTTCCTTCGTTACGAGACTGAGGAGGAAGCTCAAAAAGCTATTGAGGGAATGCATGGCAAGTTTCTAGATGGCAGAGTAATATTTGTGGAAGTTGCAAA ACCCAGATCAGAGCTTCGCCAAAGCCACAACTATGGCCACAGATAG
AA sequence Show only first row Show all	>Potri.012G038200.3 pacid=42783076 polypeptide=Potri.012G038200.3.p locus=Potri.012G038200 ID=Potri.012G038200.3.v4.1 annot-version=v4.1 MATASTIFSFKIAPNPSPVSSFKEKTMIMNPSLSWDSAKTKVRRSRFPYFTLNYIERQRLENSCSCCSVLACLPSSASSPSSFGFNFRKTKLYVSGLSFR TTEESLRNAFQNFGQLVDVNLVMDKVAKRPRGFAFLRYETEEEAQKAIEGMHGKFLDGRVIFVEVAKPRSELRQSHNYGHR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G73530			RNA-binding (RRM/RBD/RNP motif...		Potri.012G038200 [exp]	0	1
AT5G08740		NDC1	NAD(P)H dehydrogenase C1 (.1)		Potri.007G098700 [exp]	1.00	0.9512
AT4G01690		PPOX, HEMG1, PP...	Flavin containing amine oxidor...		Potri.002G186300 [exp]	8.00	0.9244
AT1G64355			unknown protein		Potri.003G138500 [exp]	8.48	0.9184
AT4G21770			Pseudouridine synthase family ...		Potri.004G019100 [exp]	8.66	0.9107
AT4G17740			Peptidase S41 family protein (...		Potri.008G173900 [exp]	10.29	0.9394
AT4G17070			peptidyl-prolyl cis-trans isom...		Potri.014G051300 [exp]	10.48	0.9211
AT5G08520	MYB		Duplicated homeodomain-like su...		Potri.007G076200 [exp]	11.18	0.9009
AT2G32500			Stress responsive alpha-beta b...		Potri.014G154900 [exp]	17.23	0.9246
AT2G36885			unknown protein		Potri.016G098900 [exp]	19.07	0.9166
					Potri.016G121650 [exp]	22.20	0.9066

Compare expression of checked genes

Potri.012G038200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.