Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G20670 39 / 2e-05 Protein of unknown function (DUF1677) (.1) AT1G79770 39 / 3e-05 Protein of unknown function (DUF1677) (.1) AT1G72510 37 / 0.0001 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2) AT5G25840 35 / 0.0007 Protein of unknown function (DUF1677) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G031700 [exp] 74 / 2e-19 AT4G14819 75 / 5e-19 Protein of unknown function (DUF1677) (.1) Potri.006G219100 [exp] 43 / 4e-07 AT1G72510 131 / 7e-40 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2) Potri.001G166900 [exp] 40 / 1e-05 AT1G72510 190 / 2e-62 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2) Potri.001G188700 [exp] 37 / 0.0002 AT1G79770 157 / 2e-49 Protein of unknown function (DUF1677) (.1) Potri.010G086000 [exp] 36 / 0.0002 AT4G14819 136 / 3e-43 Protein of unknown function (DUF1677) (.1) Potri.003G050200 [exp] 36 / 0.0003 AT5G25840 152 / 3e-47 Protein of unknown function (DUF1677) (.1) Potri.008G154500 [exp] 35 / 0.0006 AT3G22540 133 / 1e-41 Protein of unknown function (DUF1677) (.1) Potri.003G067800 [exp] 35 / 0.0008 AT1G72510 194 / 5e-64 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2) Potri.006G237300 [exp] 35 / 0.0008 AT2G25780 122 / 6e-36 Protein of unknown function (DUF1677) (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10013156 [exp] 44 / 5e-07 AT1G72510 157 / 2e-49 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2) Lus10008118 [exp] 44 / 5e-07 AT1G72510 157 / 1e-49 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2) Lus10015670 [exp] 42 / 2e-06 AT1G72510 139 / 7e-43 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2) Lus10037683 [exp] 40 / 9e-06 AT1G72510 134 / 2e-40 Protein of unknown function (DUF1677) (.1), Protein of unknown function (DUF1677) (.2) Lus10011427 [exp] 40 / 1e-05 AT5G25840 172 / 5e-55 Protein of unknown function (DUF1677) (.1) Lus10037569 [exp] 40 / 2e-05 AT5G25840 173 / 1e-55 Protein of unknown function (DUF1677) (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07911 [poplar] [flax] DUF1677 Protein of unknown function (DUF1677)
Representative CDS sequence Show only first row Show all	>Potri.012G042000.1 pacid=42783384 polypeptide=Potri.012G042000.1.p locus=Potri.012G042000 ID=Potri.012G042000.1.v4.1 annot-version=v4.1 ATGGCAAGTGGAGAAGTAGTGGAGAGAGCTGAGTGTGGGCACTGTGGTACGCGGGAAGAGAGCGCCATGGAATACGCCGGTTGGTTTCAGGAGAGGTTTG GTGGGTGTGGTCTTTGTGAGGAAGCAATCAAGGATGAACAAGCAAAGGCTTGGAGTAGGAGTTGA
AA sequence Show only first row Show all	>Potri.012G042000.1 pacid=42783384 polypeptide=Potri.012G042000.1.p locus=Potri.012G042000 ID=Potri.012G042000.1.v4.1 annot-version=v4.1 MASGEVVERAECGHCGTREESAMEYAGWFQERFGGCGLCEEAIKDEQAKAWSRS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G20670			Protein of unknown function (D...		Potri.012G042000 [exp]	0	1
AT1G03670			ankyrin repeat family protein ...		Potri.018G077500 [exp]	4.24	0.9049
AT3G49810			ARM repeat superfamily protein...		Potri.014G014300 [exp]	4.47	0.9131
AT1G07650			Leucine-rich repeat transmembr...		Potri.001G386000 [exp]	7.74	0.8791
AT3G51430		SSL5, YLS2	YELLOW-LEAF-SPECIFIC GENE 2, S...		Potri.005G099400 [exp]	12.64	0.8878
AT5G09220		AAP2	amino acid permease 2 (.1)		Potri.013G103500 [exp]	13.74	0.8883
AT1G03670			ankyrin repeat family protein ...		Potri.013G134466 [exp]	14.69	0.9022
AT2G24520		AHA5	H\(+\)-ATPase 5, H\(+\)-ATPase...		Potri.018G006000 [exp]	14.69	0.8979	Pt-VHA1.1
AT3G14840			Leucine-rich repeat transmembr...		Potri.001G385500 [exp]	15.29	0.8594
AT1G75820		ATCLV1, FLO5, F...	FLOWER DEVELOPMENT 5, FASCIATA...		Potri.005G241500 [exp]	16.24	0.8937	CLV1.2
AT2G20740			Tetraspanin family protein (.1...		Potri.018G038400 [exp]	16.73	0.8636

Compare expression of checked genes

Potri.012G042000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.