Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT4G30700 101 / 1e-25 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT1G09190 99 / 8e-25 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT1G13410 97 / 2e-24 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT4G14820 97 / 3e-24 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT4G38010 96 / 6e-24 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT1G08070 96 / 1e-23 EMB3102, OTP82 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT2G42920 94 / 3e-23 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) AT5G40405 94 / 4e-23 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) AT5G15300 93 / 7e-23 Pentatricopeptide repeat (PPR) superfamily protein (.1) AT3G08820 92 / 1e-22 Pentatricopeptide repeat (PPR) superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G034900 [exp] 190 / 4e-59 AT4G21065 370 / 2e-122 Tetratricopeptide repeat (TPR)-like superfamily protein (.1), Tetratricopeptide repeat (TPR)-like superfamily protein (.2) Potri.011G052300 [exp] 103 / 2e-26 AT2G33760 747 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Potri.006G231200 [exp] 103 / 3e-26 AT5G66520 504 / 1e-172 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G135600 [exp] 100 / 2e-25 AT4G38010 672 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1) Potri.007G050200 [exp] 100 / 2e-25 AT4G37380 817 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.008G121400 [exp] 100 / 3e-25 AT1G13410 561 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.018G040100 [exp] 100 / 3e-25 AT1G08070 974 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.012G109300 [exp] 99 / 4e-25 AT5G50990 616 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Potri.005G202600 [exp] 98 / 2e-24 AT2G42920 660 / 0.0 Pentatricopeptide repeat (PPR-like) superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039974 [exp] 101 / 1e-25 AT1G06150 612 / 0.0 EMBRYO DEFECTIVE 1444, basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.1), basic helix-loop-helix (bHLH) DNA-binding superfamily protein (.2) Lus10010385 [exp] 99 / 1e-24 AT4G37380 758 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10024971 [exp] 97 / 5e-24 AT4G37380 772 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10017446 [exp] 96 / 7e-24 AT1G11290 1152 / 0.0 CHLORORESPIRATORY REDUCTION22, Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10017243 [exp] 96 / 1e-23 AT1G13410 539 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10029436 [exp] 96 / 1e-23 AT3G08820 828 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1) Lus10021069 [exp] 94 / 4e-23 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10021068 [exp] 94 / 4e-23 AT1G13410 533 / 0.0 Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10033026 [exp] 94 / 5e-23 AT1G08070 921 / 0.0 ORGANELLE TRANSCRIPT PROCESSING 82, EMBRYO DEFECTIVE 3102, Tetratricopeptide repeat (TPR)-like superfamily protein (.1) Lus10035815 [exp] 94 / 6e-23 AT4G30700 1026 / 0.0 Pentatricopeptide repeat (PPR) superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0020 [poplar] [flax] TPR PF01535 [poplar] [flax] PPR PPR repeat CL0020 [poplar] [flax] TPR PF13041 [poplar] [flax] PPR_2 PPR repeat family
Representative CDS sequence Show only first row Show all	>Potri.012G044150.1 pacid=42782934 polypeptide=Potri.012G044150.1.p locus=Potri.012G044150 ID=Potri.012G044150.1.v4.1 annot-version=v4.1 ATGTTCAAGGATATTGAAACATCCCGCCAACAGATATTCCCAGCCTTAGTGGCATGGAATACTATGATTGGTAGTTATGTCTCTTGTGGTAAGTTCAAAG AAGCACTTGGCATGTTCTCAAGGATGATGGAACTCGGCGTAGAGCCTGACGAGGCCACACTCGTTGAGACGTTCTCTGCAGGTTCTTCATTGGGTGCATT AGATTTTGGGAGATGGGATCATTCATGTATTAGTAATACTGATCATGGGAGTATTATAGAGGTTAATTATTCACTCCTTAATATGTATGCAAAGTGTGGA GCTCTTGAAGAAGCATATGAGACATTCGATGGGATGAGCAAGAAGAATACAGTAACGTGGAATACGATGATTTTGGGACTAGCAGTCATGGCTTTGCAAA TGATGCATTGGTTCTCTTTTCCATGTTAG
AA sequence Show only first row Show all	>Potri.012G044150.1 pacid=42782934 polypeptide=Potri.012G044150.1.p locus=Potri.012G044150 ID=Potri.012G044150.1.v4.1 annot-version=v4.1 MFKDIETSRQQIFPALVAWNTMIGSYVSCGKFKEALGMFSRMMELGVEPDEATLVETFSAGSSLGALDFGRWDHSCISNTDHGSIIEVNYSLLNMYAKCG ALEEAYETFDGMSKKNTVTWNTMILGLAVMALQMMHWFSFPC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT4G30700			Pentatricopeptide repeat (PPR)...		Potri.012G044150 [exp]	0	1
AT1G73890			Bifunctional inhibitor/lipid-t...		Potri.015G053700 [exp]	133.32	0.5684

Compare expression of checked genes

Potri.012G044150 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.