Plant FIBer expression Database

Potri.012G047500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
ATCG00800 160 / 4e-51 ATCG00800.1, RPS3 structural constituent of ribosome (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.017G072340
[exp]
135 / 4e-42 ATCG00800 228 / 1e-76 structural constituent of ribosome (.1)
Flax homologues

No hit found
PFAM info
Representative CDS sequence
>Potri.012G047500.1 pacid=42782997 polypeptide=Potri.012G047500.1.p locus=Potri.012G047500 ID=Potri.012G047500.1.v4.1 annot-version=v4.1
ATGGGACAAAAAATAAATCCACTTGGTTTCAGACTTGGTACAACCCAAGATCATTATTCTCTTTGGTTTGCACAACCAAATTTTTTTTTTGAGGGTCTGC
AAGAAGATCAAAAAATAAGAAATTGTATCAAAAATTATGTACAAAAAAATATGAAAATTTCTTCTGGTGTTGAAGGAATTGGACATATAGAGATTCAAAA
ACGAATTGATGTGATTCAAGTTATAATCTATTTAGGATTCCCAAAATTTTTAACAGAAGGTAAACCTAAAAGGATCAAAGAATTATAG
AA sequence
>Potri.012G047500.1 pacid=42782997 polypeptide=Potri.012G047500.1.p locus=Potri.012G047500 ID=Potri.012G047500.1.v4.1 annot-version=v4.1
MGQKINPLGFRLGTTQDHYSLWFAQPNFFFEGLQEDQKIRNCIKNYVQKNMKISSGVEGIGHIEIQKRIDVIQVIIYLGFPKFLTEGKPKRIKEL

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
ATCG00800 ATCG00800.1, RP... structural constituent of ribo... Potri.012G047500
[exp]
0 1
ATCG00800 ATCG00800.1, RP... structural constituent of ribo... Potri.017G072340
[exp]
4.58 0.9871
ATCG00800 ATCG00800.1, RP... structural constituent of ribo... Potri.002G235600
[exp]
6.32 0.9866
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Potri.011G075200
[exp]
9.00 0.9856
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Potri.013G138900
[exp]
9.48 0.9855
ATCG00280 ATCG00280.1, PS... photosystem II reaction center... Potri.008G208700
[exp]
10.39 0.9749
ATCG00900 ATCG00900.1, RP... CHLOROPLAST RIBOSOMAL PROTEIN ... Potri.011G084201
[exp]
15.87 0.9773
ATCG01130 ATCG01130.1, YC... Ycf1 protein (.1) Potri.013G075232
[exp]
16.43 0.9768
ATCG00750 ATCG00750.1, RP... ribosomal protein S11 (.1) Potri.010G032501
[exp]
18.02 0.9835
ATCG00820 ATCG00820.1, RP... ribosomal protein S19 (.1) Potri.011G074301
[exp]
21.79 0.9802
ATCG01310 ATCG01310.1, RP... ribosomal protein L2 (.1) Potri.013G137077
[exp]
23.49 0.9789

Potri.012G047500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.