Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18170 249 / 3e-83 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G73655 205 / 4e-66 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G10060 59 / 3e-10 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G26555 57 / 2e-09 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT4G19830 53 / 3e-08 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G05420 50 / 1e-07 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G12340 49 / 1e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT5G13410 46 / 8e-06 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT1G20810 44 / 5e-05 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) AT3G60370 43 / 0.0001 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.012G119800 [exp] 56 / 5e-09 AT4G19830 270 / 5e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.016G096600 [exp] 55 / 6e-09 AT3G10060 272 / 6e-93 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G068300 [exp] 50 / 3e-07 AT5G13410 332 / 4e-116 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.001G467100 [exp] 47 / 5e-06 AT4G26555 268 / 3e-92 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.014G045600 [exp] 46 / 8e-06 AT3G60370 302 / 3e-104 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Potri.015G130900 [exp] 47 / 9e-06 AT4G25340 204 / 1e-59 FK506 BINDING PROTEIN 53 (.1.2) Potri.001G075500 [exp] 45 / 1e-05 AT5G45680 253 / 7e-86 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Potri.012G129200 [exp] 44 / 9e-05 AT4G25340 344 / 1e-113 FK506 BINDING PROTEIN 53 (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10031342 [exp] 223 / 1e-73 AT1G18170 261 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10038954 [exp] 165 / 2e-50 AT1G18170 193 / 1e-61 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10027246 [exp] 157 / 1e-47 AT1G18170 187 / 2e-59 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10009062 [exp] 76 / 2e-15 AT1G73660 673 / 0.0 protein tyrosine kinase family protein (.1) Lus10035560 [exp] 58 / 7e-10 AT3G10060 296 / 2e-102 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10036206 [exp] 52 / 4e-08 AT4G19830 260 / 4e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10038345 [exp] 52 / 5e-08 AT4G19830 262 / 3e-89 FKBP-like peptidyl-prolyl cis-trans isomerase family protein (.1) Lus10031700 [exp] 52 / 2e-07 AT4G25340 324 / 3e-105 FK506 BINDING PROTEIN 53 (.1.2) Lus10006949 [exp] 51 / 2e-07 AT5G45680 244 / 2e-82 FK506 BINDING PROTEIN 13, FK506-binding protein 13 (.1) Lus10032895 [exp] 50 / 7e-07 AT4G26550 338 / 8e-116 Got1/Sft2-like vescicle transport protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0487 [poplar] [flax] FKBP PF00254 [poplar] [flax] FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase
Representative CDS sequence Show only first row Show all	>Potri.012G048300.1 pacid=42783202 polypeptide=Potri.012G048300.1.p locus=Potri.012G048300 ID=Potri.012G048300.1.v4.1 annot-version=v4.1 ATGGCTACCTTCTTTGGGTCTCCACCATTTCTTTCCCATCCGTTAACAAGAACTAACTTTTCTTCGTCATCACAAACACCTCCGCCTCCCACCCCACCTA TCCCACCCTCGCAGCCAAATCCATCTCCACAGCTAAGCAGCAGTTCATCTGAGCAACCGCAGCTACCAGCCTCGGTTAGAGTGCAACAGCAGAAGCCTGC TAAACCTGCTGGCAATTCTGCTACCAAAGTTGAAACCACTGACTGGATAGCTTCCACATTAACTAGGCGGTTCGGCCTTGGTGCTGGCCTAGCATGGGCA GCCTTTCTTGCAGTTGGTGTGGTTTCAGAACAAATCAAGACCCGCATCGAAGTCTCCCAACAAGAAGCAAATACAAGAAATGTTGGTAAAGAGGAAGAGG TAGCATTACCTAATGGCATAAGGTACTATGAGTTGAGAGTAGGTGGCGGGGCTTCTCCAAAGACAGGGGACTTAGTGGTGATTGATCTCAAGGGGAAAAT TGAAGGCAGTGGAGAAGTGTTTGTGGACACATTTGGCGGTGACAGGAAACCATTGGCTTTAGTAATGGGGTCAAGGCCTTATAGCAAGGGAATGTGTGAA GGGGTAGAATATGTACTGAGATCAGTGAAGGCTGGAGGCAAAAGGAGAGTTATAGTCCCTCCTAATTTAGGTTTTAGAGAGAATGGTGCAGATTTAGGCA CCGGTGTGCAGATTCCACCATTTGCAACTCTTGAGTATATTGTTGAGGTTGAGAGAGTTTCCATTGCACCAGCTTAA
AA sequence Show only first row Show all	>Potri.012G048300.1 pacid=42783202 polypeptide=Potri.012G048300.1.p locus=Potri.012G048300 ID=Potri.012G048300.1.v4.1 annot-version=v4.1 MATFFGSPPFLSHPLTRTNFSSSSQTPPPPTPPIPPSQPNPSPQLSSSSSEQPQLPASVRVQQQKPAKPAGNSATKVETTDWIASTLTRRFGLGAGLAWA AFLAVGVVSEQIKTRIEVSQQEANTRNVGKEEEVALPNGIRYYELRVGGGASPKTGDLVVIDLKGKIEGSGEVFVDTFGGDRKPLALVMGSRPYSKGMCE GVEYVLRSVKAGGKRRVIVPPNLGFRENGADLGTGVQIPPFATLEYIVEVERVSIAPA

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G18170			FKBP-like peptidyl-prolyl cis-...		Potri.012G048300 [exp]	0	1
AT4G08570			Heavy metal transport/detoxifi...		Potri.005G003700 [exp]	2.00	0.9618
AT5G27330			Prefoldin chaperone subunit fa...		Potri.013G028600 [exp]	3.87	0.9437
AT3G15110			unknown protein		Potri.011G097800 [exp]	4.24	0.9680
AT3G53160		UGT73C7	UDP-glucosyl transferase 73C7 ...		Potri.001G133100 [exp]	8.06	0.9164
AT1G64770		PnsB2, NDH45, N...	Photosynthetic NDH subcomplex...		Potri.019G034100 [exp]	10.09	0.9580
AT4G20360		AtRab8D, AtRABE...	RAB GTPase homolog E1B (.1)		Potri.001G110200 [exp]	11.22	0.9632
AT2G46820		PSI-P, TMP14, P...	THYLAKOID MEMBRANE PHOSPHOPROT...		Potri.014G106400 [exp]	14.66	0.9584	TMP14.2
AT5G52010	C2H2ZnF		C2H2-like zinc finger protein ...		Potri.014G025100 [exp]	16.24	0.9514
AT1G69935		SHW1	short hypocotyl in white light...		Potri.008G190900 [exp]	16.94	0.9556
AT4G28025			unknown protein		Potri.006G175600 [exp]	17.32	0.9454

Compare expression of checked genes

Potri.012G048300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.