Potri.012G048550 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G048550.1 pacid=42783009 polypeptide=Potri.012G048550.1.p locus=Potri.012G048550 ID=Potri.012G048550.1.v4.1 annot-version=v4.1
ATGGCTTCTTATCAGGATCATGGTGTAGAACTCCCACAGATTCAAGAAGAGGCACCCCATGTAGAGGGATGGGAACAAGAGATTCAGAAAGAGAAAAGAC
CATGGGATCCGTACAGCCACGTGTCAGGTAGGTGTTTTACACAATAA
AA sequence
>Potri.012G048550.1 pacid=42783009 polypeptide=Potri.012G048550.1.p locus=Potri.012G048550 ID=Potri.012G048550.1.v4.1 annot-version=v4.1
MASYQDHGVELPQIQEEAPHVEGWEQEIQKEKRPWDPYSHVSGRCFTQ

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G048550 0 1
Potri.008G043250 3.46 0.8965
AT1G53163 unknown protein Potri.001G398000 6.00 0.8664
AT5G16715 EMB2247 embryo defective 2247, ATP bin... Potri.004G090732 7.74 0.8884
AT5G06620 SDG38, ATXR4 SET domain protein 38 (.1) Potri.006G196632 8.48 0.8252
Potri.019G094650 11.13 0.8938
AT1G27410 DNA repair metallo-beta-lactam... Potri.013G121201 11.53 0.8462
AT1G80000 CASC3/Barentsz eIF4AIII bindin... Potri.001G178900 12.24 0.8796
Potri.017G104001 16.52 0.8781
AT3G42170 BED zinc finger ;hAT family di... Potri.011G125951 19.05 0.8624
AT1G35670 CPK11, ATCDPK2,... calcium-dependent protein kina... Potri.019G050950 19.18 0.8506

Potri.012G048550 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.