Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	AP19.2
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G17380 307 / 6e-109 AP19 associated protein 19 (.1) AT4G35410 306 / 9e-109 Clathrin adaptor complex small chain family protein (.1.2) AT1G47830 162 / 5e-52 SNARE-like superfamily protein (.1) AT2G19790 126 / 8e-38 SNARE-like superfamily protein (.1) AT3G50860 108 / 2e-30 Clathrin adaptor complex small chain family protein (.1) AT1G60780 40 / 0.0003 HAP13 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1) AT1G10730 39 / 0.0005 Clathrin adaptor complexes medium subunit family protein (.1) AT4G24550 39 / 0.0007 Clathrin adaptor complexes medium subunit family protein (.1.2.3)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.014G079000 [exp] 313 / 1e-111 AT4G35410 291 / 1e-102 Clathrin adaptor complex small chain family protein (.1.2) Potri.002G001800 [exp] 276 / 2e-96 AT2G17380 278 / 3e-97 associated protein 19 (.1) Potri.005G238701 [exp] 165 / 4e-53 AT1G47830 275 / 8e-97 SNARE-like superfamily protein (.1) Potri.002G022900 [exp] 161 / 1e-51 AT1G47830 278 / 6e-98 SNARE-like superfamily protein (.1) Potri.006G149100 [exp] 127 / 3e-38 AT2G19790 287 / 1e-101 SNARE-like superfamily protein (.1) Potri.007G025400 [exp] 120 / 4e-35 AT3G50860 296 / 1e-104 Clathrin adaptor complex small chain family protein (.1) Potri.005G122900 [exp] 115 / 2e-33 AT3G50860 286 / 1e-100 Clathrin adaptor complex small chain family protein (.1) Potri.010G044700 [exp] 46 / 3e-06 AT1G60780 834 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1) Potri.008G187600 [exp] 43 / 3e-05 AT1G60780 831 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10026316 [exp] 286 / 9e-101 AT2G17380 297 / 7e-105 associated protein 19 (.1) Lus10042352 [exp] 288 / 1e-100 AT2G17380 297 / 3e-104 associated protein 19 (.1) Lus10003641 [exp] 255 / 2e-88 AT4G35410 251 / 8e-87 Clathrin adaptor complex small chain family protein (.1.2) Lus10024337 [exp] 161 / 2e-50 AT1G47830 274 / 5e-95 SNARE-like superfamily protein (.1) Lus10012924 [exp] 125 / 3e-37 AT2G19790 280 / 6e-99 SNARE-like superfamily protein (.1) Lus10035004 [exp] 118 / 1e-34 AT2G19790 262 / 6e-92 SNARE-like superfamily protein (.1) Lus10041742 [exp] 100 / 4e-27 AT3G50860 278 / 6e-97 Clathrin adaptor complex small chain family protein (.1) Lus10024011 [exp] 89 / 2e-22 AT3G50860 215 / 3e-72 Clathrin adaptor complex small chain family protein (.1) Lus10004626 [exp] 43 / 3e-05 AT1G60780 827 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1) Lus10026688 [exp] 43 / 3e-05 AT1G60780 813 / 0.0 HAPLESS 13, Clathrin adaptor complexes medium subunit family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0431 [poplar] [flax] PF PF01217 [poplar] [flax] Clat_adaptor_s Clathrin adaptor complex small chain
Representative CDS sequence Show only first row Show all	>Potri.012G052000.1 pacid=42783674 polypeptide=Potri.012G052000.1.p locus=Potri.012G052000 ID=Potri.012G052000.1.v4.1 annot-version=v4.1 ATGATTCAATTTGTACTTCTCATTAGTCGACAAGGAAAAGTGAGATTGACAAAATGGTATTCACCTTATACACAAAAGGAAAGAAGTAAGGTAATCCGTG AGCTCAGTGGAGTAATTTTGACTCGAGGACCCAAGCTTTGTAATTTTGTTGAATGGAGAGGACAGAAAGTTGTTTATAAAAGATATGCTAGCCTTTACTT CTGCATGTGCACTGATCAGGACGACAATGAATTAGAGGTCCTCGAAATAATTCACCATTTTGTTGAGATTTTGGACCGATACTTTGGCAGTGTCTGCGAG TTGGACTTGATCTTCAACTTCCATAAGGCCTATTATGTATTGGATGAGATTTTGATAGCTGGTGAACTTCAAGAGTCCAGCAAGAAAACAGTTGCTAGGC TAATAGCTGCCCAGGACTCATTGGTAGAGACTGCAAAAGAGCAGGCCAGTTCGATAAGCAATATCATTGCCCAGGCCACGAAGTAG
AA sequence Show only first row Show all	>Potri.012G052000.1 pacid=42783674 polypeptide=Potri.012G052000.1.p locus=Potri.012G052000 ID=Potri.012G052000.1.v4.1 annot-version=v4.1 MIQFVLLISRQGKVRLTKWYSPYTQKERSKVIRELSGVILTRGPKLCNFVEWRGQKVVYKRYASLYFCMCTDQDDNELEVLEIIHHFVEILDRYFGSVCE LDLIFNFHKAYYVLDEILIAGELQESSKKTVARLIAAQDSLVETAKEQASSISNIIAQATK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G17380		AP19	associated protein 19 (.1)		Potri.012G052000 [exp]	0	1	AP19.2
AT3G12587			Oligosaccaryltransferase (.1)		Potri.010G207100 [exp]	3.00	0.9050
AT1G47830			SNARE-like superfamily protein...		Potri.002G022900 [exp]	7.61	0.9221
AT1G02130		ARA5, AtRABD2a,...	ARABIDOPSIS THALIANA RAB D2A, ...		Potri.001G080400 [exp]	14.42	0.8929
AT3G11780			MD-2-related lipid recognition...		Potri.006G201400 [exp]	20.19	0.8891
AT2G19790			SNARE-like superfamily protein...		Potri.006G149100 [exp]	21.02	0.8786
AT4G17486			PPPDE putative thiol peptidase...		Potri.018G070600 [exp]	24.81	0.8594
AT4G35410			Clathrin adaptor complex small...		Potri.014G079000 [exp]	25.19	0.8926	AP19.1
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Potri.003G086700 [exp]	35.32	0.8676
AT3G25040		ERD2B	endoplasmic reticulum retentio...		Potri.001G315800 [exp]	38.15	0.8799
AT1G02130		ARA5, AtRABD2a,...	ARABIDOPSIS THALIANA RAB D2A, ...		Potri.014G049400 [exp]	38.66	0.8802	RAB1.2

Compare expression of checked genes

Potri.012G052000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.