Potri.012G055401 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G055401.1 pacid=42783904 polypeptide=Potri.012G055401.1.p locus=Potri.012G055401 ID=Potri.012G055401.1.v4.1 annot-version=v4.1
ATGCTGCCTGAAGCGGTTGCCATATATTGTCATGGCACCAAGAGATTCTTCGAGGAAGCATCTAGAACTATTGATTTCACTAATGGACTTCAAGATGTAA
GAGCGGTTTATAAATTAAACAAGAAAGATAGAAAGAGGGAGGTTGCTGGTGCGTGTATCCAATTCTTTAAGAGCTACAAATCCTTCTCAAGGTGCCATCT
CTTCATTTTGTGTGACAATAGAATTATCAAGACAAAGGAACTAAAGGAAGACGAAAACAGTGGTGCAGTTAAGTAA
AA sequence
>Potri.012G055401.1 pacid=42783904 polypeptide=Potri.012G055401.1.p locus=Potri.012G055401 ID=Potri.012G055401.1.v4.1 annot-version=v4.1
MLPEAVAIYCHGTKRFFEEASRTIDFTNGLQDVRAVYKLNKKDRKREVAGACIQFFKSYKSFSRCHLFILCDNRIIKTKELKEDENSGAVK

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G055401 0 1
Potri.010G080666 20.49 0.9270
AT3G50940 P-loop containing nucleoside t... Potri.005G115200 22.22 0.8000
AT2G13542 unknown protein Potri.013G008750 24.37 0.9204
AT3G47570 Leucine-rich repeat protein ki... Potri.018G120901 29.52 0.9185
Potri.005G071951 33.16 0.7640
AT3G14260 Protein of unknown function (D... Potri.003G125300 33.16 0.9175
AT4G33230 Plant invertase/pectin methyle... Potri.003G021300 36.08 0.9088
AT5G39840 ATP-dependent RNA helicase, mi... Potri.017G081900 40.39 0.9083
AT3G21490 Heavy metal transport/detoxifi... Potri.010G015300 41.78 0.8714
AT1G01460 ATPIPK11 Phosphatidylinositol-4-phospha... Potri.014G093300 44.94 0.9023

Potri.012G055401 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.