Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G18400 317 / 5e-108 NAC ANAC058 NAC domain containing protein 58 (.1) AT5G53950 252 / 6e-82 NAC ATCUC2, CUC2, ANAC098 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT2G24430 250 / 8e-82 NAC ANAC039, ANAC038 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) AT5G18270 249 / 3e-81 NAC ANAC087 Arabidopsis NAC domain containing protein 87 (.1.2) AT5G61430 249 / 3e-81 NAC ANAC100, ATNAC5 NAC domain containing protein 100 (.1) AT5G07680 246 / 3e-80 NAC ANAC079, ATNAC4, ANAC080 Arabidopsis NAC domain containing protein 79, NAC domain containing protein 80 (.1.2) AT5G39610 237 / 3e-77 NAC ORE1, AtNAC2, ANAC092, ATNAC6 ORESARA 1, NAC domain containing protein 2, Arabidopsis NAC domain containing protein 92, NAC domain containing protein 6 (.1) AT1G76420 232 / 1e-74 NAC NAC368, CUC3, ANAC031 CUP SHAPED COTYLEDON3, Arabidopsis NAC domain containing protein 31, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) AT3G04060 230 / 7e-74 NAC ANAC046 NAC domain containing protein 46 (.1) AT3G15170 229 / 1e-73 NAC ATNAC1, CUC1, ANAC054 CUP-SHAPED COTYLEDON1, Arabidopsis NAC domain containing protein 54, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G046800 [exp] 511 / 0 AT3G18400 326 / 1e-111 NAC domain containing protein 58 (.1) Potri.006G277000 [exp] 270 / 5e-89 AT2G24430 340 / 1e-116 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.018G003800 [exp] 265 / 5e-87 AT2G24430 350 / 1e-120 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Potri.011G115400 [exp] 251 / 1e-81 AT5G53950 312 / 1e-104 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Potri.012G001400 [exp] 250 / 2e-81 AT5G61430 448 / 1e-158 NAC domain containing protein 100 (.1) Potri.017G086200 [exp] 248 / 1e-80 AT5G61430 386 / 2e-134 NAC domain containing protein 100 (.1) Potri.015G020000 [exp] 248 / 2e-80 AT5G61430 446 / 1e-157 NAC domain containing protein 100 (.1) Potri.019G031600 [exp] 246 / 2e-79 AT5G18270 328 / 6e-111 Arabidopsis NAC domain containing protein 87 (.1.2) Potri.001G396300 [exp] 243 / 5e-79 AT5G53950 299 / 5e-100 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009029 [exp] 318 / 5e-108 AT3G18400 311 / 3e-105 NAC domain containing protein 58 (.1) Lus10009669 [exp] 311 / 4e-105 AT3G18400 308 / 3e-104 NAC domain containing protein 58 (.1) Lus10027227 [exp] 283 / 4e-95 AT3G18400 275 / 1e-91 NAC domain containing protein 58 (.1) Lus10038937 [exp] 283 / 5e-95 AT3G18400 268 / 5e-89 NAC domain containing protein 58 (.1) Lus10020165 [exp] 258 / 6e-84 AT2G24430 306 / 2e-102 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10026966 [exp] 254 / 1e-82 AT2G24430 311 / 6e-105 Arabidopsis NAC domain containing protein 39, NAC domain containing protein 38 (.1.2) Lus10005537 [exp] 252 / 1e-82 AT5G53950 317 / 3e-107 CUP-SHAPED COTYLEDON 2, Arabidopsis NAC domain containing protein 98, NAC (No Apical Meristem) domain transcriptional regulator superfamily protein (.1) Lus10001648 [exp] 248 / 1e-80 AT5G61430 359 / 4e-124 NAC domain containing protein 100 (.1) Lus10021659 [exp] 248 / 1e-80 AT5G61430 361 / 8e-125 NAC domain containing protein 100 (.1) Lus10026879 [exp] 240 / 3e-77 AT5G18270 325 / 3e-110 Arabidopsis NAC domain containing protein 87 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02365 [poplar] [flax] NAM No apical meristem (NAM) protein
Representative CDS sequence Show only first row Show all	>Potri.012G056300.2 pacid=42783454 polypeptide=Potri.012G056300.2.p locus=Potri.012G056300 ID=Potri.012G056300.2.v4.1 annot-version=v4.1 ATGGAGGAAAATCTTCCTCCTGGATTCAGGTTCCATCCAACAGATGAAGAGCTCATTACATGTTATCTAACACGCAAGGTATCTGACACCAGTTTCACCT CCAAAGCCATGGTAGATGTTGATCTCAATAAGTGTGAACCTTGGGATCTCCCAGGCAAGGCGTCCATGGGAGAGAAAGAATGGTACTTCTTTAGCTTGAG AGACAGAAAATACCCAACTGGACTCCGAACCAACAGAGCCACAGAAGCAGGCTACTGGAAAACCACAGGGAAAGACAAGGAAATCTTTCGTGCTGGAGTG CTGGTAGGAATGAAGAAAACCCTAGTGTTCTACAGGGGTAGAGCTCCAAGGGGTGAGAAAAGTAACTGGGTTATGCATGAGTACAGGCTAGATGACAAGC ATCCTTTCAAGTCCACAAAGGAGGAATGGGTAGTTTGTAGGGTTTTTCAGAAGAGCACAGAAGTCAAAAAACCACAGCAGGAACCATCCTCTCAGCAATC TCTAGGGTCTCCATGTGATACAAACTCAATTGTCAATGATAAGTTCGGAGATATTGCCAATTCATCCAGTGGGTTCAATAACATTTTAGCACACAGTTAC AACAACGAAAGCAATGTAAATGTGGACTCGCACATGAATTGGGCTGCAGCAAGAGAAGCAGCAACTCTCCCTTCACTCGCATGGCCTTCAGGATTGCTAA GCACAAACCTTACAATGAATTCCTTGCTGCTCAAAGCATTGCAACTCAGGAGTTATCAACAAAGAGAAGCTACAACTACAAATTACTCGTTTCTGACAAA TGGGATCCCTCATGAGTATGGGGCTGCTTTAGGTTCAAATTTCCAAGCTTCTTCTTCTAAGGTTTTAGACTCAGCGCCACAGCCACAGCAGGAGCAACCA TTCAGTTTGGACTCCATTAATTGGTAA
AA sequence Show only first row Show all	>Potri.012G056300.2 pacid=42783454 polypeptide=Potri.012G056300.2.p locus=Potri.012G056300 ID=Potri.012G056300.2.v4.1 annot-version=v4.1 MEENLPPGFRFHPTDEELITCYLTRKVSDTSFTSKAMVDVDLNKCEPWDLPGKASMGEKEWYFFSLRDRKYPTGLRTNRATEAGYWKTTGKDKEIFRAGV LVGMKKTLVFYRGRAPRGEKSNWVMHEYRLDDKHPFKSTKEEWVVCRVFQKSTEVKKPQQEPSSQQSLGSPCDTNSIVNDKFGDIANSSSGFNNILAHSY NNESNVNVDSHMNWAAAREAATLPSLAWPSGLLSTNLTMNSLLLKALQLRSYQQREATTTNYSFLTNGIPHEYGAALGSNFQASSSKVLDSAPQPQQEQP FSLDSINW

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Potri.012G056300 [exp]	0	1
AT4G20390			Uncharacterised protein family...		Potri.011G154900 [exp]	2.00	0.9829
AT5G41040			HXXXD-type acyl-transferase fa...		Potri.001G326300 [exp]	2.64	0.9795
AT1G04520		PDLP2	plasmodesmata-located protein ...		Potri.013G048200 [exp]	3.16	0.9824
AT1G53270		ABCG10	ATP-binding cassette G10, ABC-...		Potri.001G393300 [exp]	3.46	0.9800	3
AT5G22810			GDSL-like Lipase/Acylhydrolase...		Potri.009G151000 [exp]	4.24	0.9763
AT1G74460			GDSL-like Lipase/Acylhydrolase...		Potri.012G068700 [exp]	4.58	0.9808
AT5G06090		ATGPAT7, GPAT7	glycerol-3-phosphate acyltrans...		Potri.008G058200 [exp]	5.47	0.9797
AT1G68850			Peroxidase superfamily protein...		Potri.008G110600 [exp]	5.47	0.9795
AT5G58860		CYP86A1	"cytochrome P450, family 86, s...		Potri.009G043700 [exp]	5.65	0.9787	CYP86A19,Pt-CYP86.4
AT3G18400	NAC	ANAC058	NAC domain containing protein ...		Potri.015G046800 [exp]	6.00	0.9749

Compare expression of checked genes

Potri.012G056300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.