Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G49140 181 / 5e-61 Complex I subunit NDUFS6 (.1) AT3G18410 181 / 7e-61 Complex I subunit NDUFS6 (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G054700 [exp] 218 / 1e-75 AT1G49140 149 / 3e-48 Complex I subunit NDUFS6 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10009027 [exp] 176 / 2e-58 AT3G18410 181 / 7e-61 Complex I subunit NDUFS6 (.1.2) Lus10009665 [exp] 168 / 1e-54 AT3G18410 174 / 9e-57 Complex I subunit NDUFS6 (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF10249 [poplar] [flax] NDUFB10 NADH-ubiquinone oxidoreductase subunit 10
Representative CDS sequence Show only first row Show all	>Potri.012G056900.1 pacid=42783496 polypeptide=Potri.012G056900.1.p locus=Potri.012G056900 ID=Potri.012G056900.1.v4.1 annot-version=v4.1 ATGGGGAGGAAGAAGGGAGTAGCAGAGTTCGAGGAGTCGCCTCCAGATGACTTTGATCCATCGAATCCATACAAGGACCCAGTGGTGATGCTGGAAATGA GAGAGCATATTGTTAGAGAGAAATGGATTGATATAGAGAAAGCCAAGATCTTGAGAGAGAGACTTCGATGGTGTTATCGCATTGAAGGAATTAATCATCT CCAGAAGTGCCGCCATCTTGTCCAACAGTATCTTGACTCCACTCGTGGGATCGGGTGGGGCAAGGACCAACGCCCTCCTTGTCTCCACGGTCCTAAGGTG GAGGCAACAGCTGAGTCTGAATGA
AA sequence Show only first row Show all	>Potri.012G056900.1 pacid=42783496 polypeptide=Potri.012G056900.1.p locus=Potri.012G056900 ID=Potri.012G056900.1.v4.1 annot-version=v4.1 MGRKKGVAEFEESPPDDFDPSNPYKDPVVMLEMREHIVREKWIDIEKAKILRERLRWCYRIEGINHLQKCRHLVQQYLDSTRGIGWGKDQRPPCLHGPKV EATAESE

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G49140			Complex I subunit NDUFS6 (.1)		Potri.012G056900 [exp]	0	1
AT3G12260			LYR family of Fe/S cluster bio...		Potri.001G029900 [exp]	1.41	0.9481
AT2G21870		MGP1	MALE GAMETOPHYTE DEFECTIVE 1, ...		Potri.005G085500 [exp]	1.73	0.9451
AT1G12310			Calcium-binding EF-hand family...		Potri.001G117900 [exp]	3.46	0.9345
AT5G59910		HTB4	Histone superfamily protein (....		Potri.008G030500 [exp]	3.74	0.9328
AT1G04630		MEE4	maternal effect embryo arrest ...		Potri.003G173800 [exp]	5.83	0.9141
AT5G58060		ATYKT61, ATGP1,...	SNARE-like superfamily protein...		Potri.006G187700 [exp]	6.16	0.9126
AT5G50460			secE/sec61-gamma protein trans...		Potri.001G329400 [exp]	7.07	0.9360
AT5G15320			unknown protein		Potri.002G024900 [exp]	8.71	0.9371
AT5G15770		ATGNA1	glucose-6-phosphate acetyltran...		Potri.018G086400 [exp]	8.77	0.9220
AT5G53650			unknown protein		Potri.015G006500 [exp]	10.39	0.9131

Compare expression of checked genes

Potri.012G056900 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.