Potri.012G059400 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT3G18570 113 / 3e-32 Oleosin family protein (.1)
AT1G48990 98 / 2e-26 Oleosin family protein (.1)
AT4G25140 60 / 1e-11 OLE1, OLEO1 oleosin 1 (.1)
AT2G25890 53 / 2e-09 Oleosin family protein (.1)
AT5G40420 50 / 5e-08 OLE2, PA23, OLEO2 oleosin 2 (.1)
AT3G27660 50 / 9e-08 OLE3, OLEO4 OLEOSIN 3, oleosin 4 (.1)
AT5G51210 43 / 1e-05 OLEO3 oleosin3 (.1)
AT3G01570 40 / 0.0002 Oleosin family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.006G234900 66 / 3e-14 AT2G25890 113 / 1e-32 Oleosin family protein (.1)
Potri.001G080000 62 / 1e-12 AT4G25140 108 / 1e-30 oleosin 1 (.1)
Potri.003G150600 54 / 1e-09 AT4G25140 124 / 3e-37 oleosin 1 (.1)
Potri.015G081901 53 / 3e-09 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.T125308 53 / 3e-09 AT5G40420 108 / 5e-30 oleosin 2 (.1)
Potri.018G057800 52 / 6e-09 AT2G25890 91 / 5e-24 Oleosin family protein (.1)
Potri.012G083400 47 / 6e-07 AT5G40420 97 / 2e-25 oleosin 2 (.1)
Potri.001G345800 44 / 7e-06 AT3G01570 140 / 6e-43 Oleosin family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10032461 128 / 5e-38 AT3G18570 142 / 1e-43 Oleosin family protein (.1)
Lus10042957 127 / 1e-37 AT3G18570 139 / 2e-42 Oleosin family protein (.1)
Lus10017992 117 / 1e-33 AT3G18570 136 / 4e-41 Oleosin family protein (.1)
Lus10041987 112 / 2e-31 AT3G18570 129 / 2e-38 Oleosin family protein (.1)
Lus10031387 62 / 1e-12 AT4G25140 164 / 1e-52 oleosin 1 (.1)
Lus10027161 62 / 2e-12 AT4G25140 154 / 3e-48 oleosin 1 (.1)
Lus10039683 59 / 2e-11 AT4G25140 159 / 2e-50 oleosin 1 (.1)
Lus10010943 60 / 7e-11 AT1G22400 535 / 0.0 ARABIDOPSIS THALIANA UDP-GLUCOSYL TRANSFERASE 85A1, UDP-Glycosyltransferase superfamily protein (.1)
Lus10022141 58 / 2e-10 AT4G25140 106 / 3e-28 oleosin 1 (.1)
Lus10017460 57 / 2e-10 AT4G25140 136 / 9e-42 oleosin 1 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF01277 Oleosin Oleosin
Representative CDS sequence
>Potri.012G059400.1 pacid=42782964 polypeptide=Potri.012G059400.1.p locus=Potri.012G059400 ID=Potri.012G059400.1.v4.1 annot-version=v4.1
ATGGCTGACCGTGCCCCTACCCAGAGAGCTACAAGACCCACCACCACTCCCACCACCCACAATGGCTCTACATTTCTACGTAAACTCCAAGTCCATATCG
GATCAAACTCAAGCCAACTTGTTGGTTTGTTGACTCTTATCATCTCCGGCTCCATTCTCCTTCTCCTTACAGTGATCACTGTCACAGGATCAGTACTCGG
GTTGACCCTTTTAACTCCTTTGATCATCATTTCAAGCCCCATATGGATCCCTATAGGCATAGTCCTCTTCTTTGTTGTTGCTGGGTTCTTATCTTTTTGC
GGGTTCGGATTGGCCGTCGTGGCTGGATTGTCATGGGTGTATAAGTATTTTAGAGGGTTGAATCCACCTGGGTCGGACCAGGTCGATTATGCTCGTAACA
GAATCTACGATACAGCGAGCCATGTGAAGGACTACGCCAGGGAGTATGGTGGGTACTTGCAGAGCAAGGTGAAGGATGCGGCTCCTGGTGCCTGA
AA sequence
>Potri.012G059400.1 pacid=42782964 polypeptide=Potri.012G059400.1.p locus=Potri.012G059400 ID=Potri.012G059400.1.v4.1 annot-version=v4.1
MADRAPTQRATRPTTTPTTHNGSTFLRKLQVHIGSNSSQLVGLLTLIISGSILLLLTVITVTGSVLGLTLLTPLIIISSPIWIPIGIVLFFVVAGFLSFC
GFGLAVVAGLSWVYKYFRGLNPPGSDQVDYARNRIYDTASHVKDYAREYGGYLQSKVKDAAPGA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT3G18570 Oleosin family protein (.1) Potri.012G059400 0 1
AT3G05975 Late embryogenesis abundant (L... Potri.006G112700 2.00 0.8433
AT3G26380 Melibiase family protein (.1) Potri.010G048400 3.74 0.7736
AT2G46300 Late embryogenesis abundant (L... Potri.002G167300 3.87 0.7851
AT5G11190 AP2_ERF SHN2, SHN3 shine2, Integrase-type DNA-bin... Potri.006G253800 4.47 0.7592
AT5G18590 Galactose oxidase/kelch repeat... Potri.008G214900 10.81 0.7524
AT1G01630 Sec14p-like phosphatidylinosit... Potri.001G068000 17.86 0.7558
AT2G23540 GDSL-like Lipase/Acylhydrolase... Potri.008G104700 24.24 0.6702
AT5G52900 MAKR6 MEMBRANE-ASSOCIATED KINASE REG... Potri.012G035200 27.33 0.7907
AT2G25220 Protein kinase superfamily pro... Potri.003G179500 27.60 0.7800
AT4G37080 Protein of unknown function, D... Potri.005G136401 28.14 0.7641

Potri.012G059400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.