Potri.012G062650 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.011G072716 63 / 5e-15 ND /
Potri.T124303 59 / 3e-13 ND /
Flax homologues

No hit found

PFAM info
Representative CDS sequence
>Potri.012G062650.1 pacid=42783667 polypeptide=Potri.012G062650.1.p locus=Potri.012G062650 ID=Potri.012G062650.1.v4.1 annot-version=v4.1
ATGGTTAAGATCGGAAATGAACACTCCTACCAGAAATTGTACTTCCTGAATAGTAGGTCTCCAAATTTCAAGAGAAGCATTCACTCGACTTCTCAGGAGC
TCGTATAG
AA sequence
>Potri.012G062650.1 pacid=42783667 polypeptide=Potri.012G062650.1.p locus=Potri.012G062650 ID=Potri.012G062650.1.v4.1 annot-version=v4.1
MVKIGNEHSYQKLYFLNSRSPNFKRSIHSTSQELV

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G062650 0 1
AT2G04160 AIR3 AUXIN-INDUCED IN ROOT CULTURES... Potri.011G050300 6.55 0.8272
Potri.010G007855 8.36 0.7862
AT2G04160 AIR3 AUXIN-INDUCED IN ROOT CULTURES... Potri.011G050100 9.16 0.8268
AT2G04160 AIR3 AUXIN-INDUCED IN ROOT CULTURES... Potri.011G050000 18.00 0.8074
AT1G52360 Coatomer, beta' subunit (.1.2) Potri.006G250200 19.39 0.7443
AT5G66580 unknown protein Potri.009G110700 20.49 0.7510
AT5G10625 unknown protein Potri.006G276100 24.08 0.7349
Potri.004G194250 24.49 0.7278
AT1G23420 YABBY INO, YAB4 INNER NO OUTER, Plant-specific... Potri.008G189000 27.11 0.7240
Potri.005G149001 28.00 0.7240

Potri.012G062650 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.