Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G07960 172 / 4e-57 unknown protein
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G056300 [exp] 202 / 2e-69 AT5G07960 165 / 1e-54 unknown protein
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021623 [exp] 172 / 4e-57 AT5G07960 169 / 4e-56 unknown protein Lus10034695 [exp] 170 / 2e-56 AT5G07960 169 / 5e-56 unknown protein
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03669 [poplar] [flax] UPF0139 Uncharacterised protein family (UPF0139)
Representative CDS sequence Show only first row Show all	>Potri.012G065500.1 pacid=42783986 polypeptide=Potri.012G065500.1.p locus=Potri.012G065500 ID=Potri.012G065500.1.v4.1 annot-version=v4.1 ATGTCGTCACACAACTACAACCCAGCGTCAGCGAACGATCCACGGCAGCCGTCAGCGTCGAAATCGTTCCTGGCACCGATGGTTTCACCACAGGATGTAC CCGTTGATTACTCAGGTTTCGTTGCGGTTATCCTTGGCGTGGCTGGCGTCATGTTCAGGTACAAGCTTTGCTCGTGGCTTGCTCTCATATTCTGTGCCCA ATCACTTTCAAACATGAGGAATATGGAAAATGATCTTAAGCAGATTTCCATGGCATCCATGTTTGCAATCATGGGATTGGTTACAAATTACTTGGGCCCT GCTCGACCTGCCTCCCAAAGTTGA
AA sequence Show only first row Show all	>Potri.012G065500.1 pacid=42783986 polypeptide=Potri.012G065500.1.p locus=Potri.012G065500 ID=Potri.012G065500.1.v4.1 annot-version=v4.1 MSSHNYNPASANDPRQPSASKSFLAPMVSPQDVPVDYSGFVAVILGVAGVMFRYKLCSWLALIFCAQSLSNMRNMENDLKQISMASMFAIMGLVTNYLGP ARPASQS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G07960			unknown protein		Potri.012G065500 [exp]	0	1
AT3G05530		ATS6A.2, RPT5A	regulatory particle triple-A A...		Potri.013G016800 [exp]	1.73	0.7880	RPT5.2
AT5G01650			Tautomerase/MIF superfamily pr...		Potri.006G104600 [exp]	1.73	0.7749
AT1G06110		SKIP16	SKP1/ASK-interacting protein 1...		Potri.017G027000 [exp]	2.23	0.7586
AT2G30050			transducin family protein / WD...		Potri.015G068900 [exp]	4.24	0.7294
AT1G51060		HTA10	histone H2A 10 (.1)		Potri.001G415700 [exp]	4.47	0.7847	HTA903
AT1G29150		RPN6, ATS9	REGULATORY PARTICLE NON-ATPASE...		Potri.008G042400 [exp]	4.89	0.7476	ATS9.3
AT2G43790		ATMAPK6, MAPK6,...	MAP kinase 6 (.1)		Potri.007G139800 [exp]	6.63	0.7245	Pt-MPK6.1
AT1G29850			double-stranded DNA-binding fa...		Potri.001G352600 [exp]	6.92	0.7706
AT4G02080		ASAR1, ATSARA1C...	secretion-associated RAS super...		Potri.013G009900 [exp]	9.21	0.6935
AT1G80780			Polynucleotidyl transferase, r...		Potri.003G181100 [exp]	13.07	0.6909

Compare expression of checked genes

Potri.012G065500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.