Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G18650 142 / 1e-42 PDCB3 plasmodesmata callose-binding protein 3 (.1) AT5G61130 123 / 3e-35 PDCB1 plasmodesmata callose-binding protein 1 (.1) AT5G08000 120 / 2e-34 PDCB2, E13L3 PLASMODESMATA CALLOSE-BINDING PROTEIN 2, "glucan endo-1,3-beta-glucosidase-like protein 3", glucan endo-1,3-beta-glucosidase-like protein 3 (.1) AT4G13600 105 / 6e-28 Carbohydrate-binding X8 domain superfamily protein (.1) AT2G03505 102 / 3e-27 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G13830 100 / 2e-26 Carbohydrate-binding X8 domain superfamily protein (.1) AT1G69295 100 / 9e-26 PDCB4 plasmodesmata callose-binding protein 4 (.1) AT1G79480 94 / 1e-22 Carbohydrate-binding X8 domain superfamily protein (.1.2) AT1G26450 90 / 3e-22 Carbohydrate-binding X8 domain superfamily protein (.1) AT5G24318 91 / 2e-21 O-Glycosyl hydrolases family 17 protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G057800 [exp] 171 / 1e-53 AT1G18650 151 / 3e-46 plasmodesmata callose-binding protein 3 (.1) Potri.010G158900 [exp] 119 / 2e-33 AT1G18650 129 / 1e-37 plasmodesmata callose-binding protein 3 (.1) Potri.008G095300 [exp] 116 / 9e-33 AT1G18650 140 / 2e-42 plasmodesmata callose-binding protein 3 (.1) Potri.017G055700 [exp] 113 / 3e-31 AT4G13600 152 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.001G315700 [exp] 109 / 2e-29 AT4G13600 155 / 2e-47 Carbohydrate-binding X8 domain superfamily protein (.1) Potri.004G153800 [exp] 102 / 2e-25 AT4G34480 649 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.008G082900 [exp] 99 / 2e-24 AT1G79480 159 / 3e-45 Carbohydrate-binding X8 domain superfamily protein (.1.2) Potri.009G115400 [exp] 98 / 7e-24 AT4G34480 645 / 0.0 O-Glycosyl hydrolases family 17 protein (.1) Potri.010G173500 [exp] 97 / 1e-23 AT1G79480 162 / 3e-46 Carbohydrate-binding X8 domain superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10040522 [exp] 164 / 1e-50 AT1G18650 158 / 7e-49 plasmodesmata callose-binding protein 3 (.1) Lus10021157 [exp] 160 / 1e-49 AT1G18650 157 / 7e-49 plasmodesmata callose-binding protein 3 (.1) Lus10034690 [exp] 159 / 2e-48 AT1G18650 157 / 8e-48 plasmodesmata callose-binding protein 3 (.1) Lus10021619 [exp] 154 / 3e-46 AT1G18650 151 / 1e-45 plasmodesmata callose-binding protein 3 (.1) Lus10037071 [exp] 124 / 3e-35 AT1G18650 138 / 3e-41 plasmodesmata callose-binding protein 3 (.1) Lus10036914 [exp] 123 / 6e-35 AT1G18650 139 / 2e-41 plasmodesmata callose-binding protein 3 (.1) Lus10026662 [exp] 114 / 3e-31 AT1G18650 145 / 2e-43 plasmodesmata callose-binding protein 3 (.1) Lus10004650 [exp] 113 / 6e-31 AT1G18650 141 / 4e-42 plasmodesmata callose-binding protein 3 (.1) Lus10032601 [exp] 109 / 6e-30 AT4G13600 167 / 2e-52 Carbohydrate-binding X8 domain superfamily protein (.1) Lus10003803 [exp] 102 / 6e-25 AT3G20650 581 / 0.0 mRNA capping enzyme family protein (.1.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF07983 [poplar] [flax] X8 X8 domain
Representative CDS sequence Show only first row Show all	>Potri.012G065750.1 pacid=42782648 polypeptide=Potri.012G065750.1.p locus=Potri.012G065750 ID=Potri.012G065750.1.v4.1 annot-version=v4.1 ATGGCTCTTTTAGTGCTTGCAATGCTCATGTTGGCCATGACTGGTCGTGCAAGTTGCACATGGTGTGTTTGCAAGGAAATGAGCGATTCAGTCCTCCAGC AGACTCTAGACTATGCTTGTGGAGCTGGGGCTGATTGTGGCCCTGTCCATCAAAATGGCGCTTGTTTCCAACCCAATACTGTCAGGGCTCATTGCAATTA TGCTGTGAACAGCTACTTCCAAAGAAAGGGTCAGGCTCAAGGCACCTGTGATTTTAAAGGCACTGCAACGGTTTCCGCATCTGATCCTAGCATTAATGGC TGCTCTTATCCTTCCAGTGTCAGCGCTGCAGGCACCAGCACAACTCCAACTCCAGTCACCGCAACGCCAACTCCGGTAACCACAAATCCATCCACTACCA CACCCTCGACCACAACCCCATCCACCACCACACCCTCGACCACAACCCCATCCTCTACCACTCCCACCACTCCATACTCGGCAACACCTAATGGAGTGCT AGGAGGGATTGGCAATGGACTAGGTCCATCGGGAGCTGGAATAAACACAGACATCCCTGATGCTGGGTTAAGACTTGAAAACACTGGCTTGTTCTCATTC TTTATAATCCTTGTGGTATCCAGTTTGATGCTTTAG
AA sequence Show only first row Show all	>Potri.012G065750.1 pacid=42782648 polypeptide=Potri.012G065750.1.p locus=Potri.012G065750 ID=Potri.012G065750.1.v4.1 annot-version=v4.1 MALLVLAMLMLAMTGRASCTWCVCKEMSDSVLQQTLDYACGAGADCGPVHQNGACFQPNTVRAHCNYAVNSYFQRKGQAQGTCDFKGTATVSASDPSING CSYPSSVSAAGTSTTPTPVTATPTPVTTNPSTTTPSTTTPSTTTPSTTTPSSTTPTTPYSATPNGVLGGIGNGLGPSGAGINTDIPDAGLRLENTGLFSF FIILVVSSLML

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G18650		PDCB3	plasmodesmata callose-binding ...		Potri.012G065750 [exp]	0	1
AT3G25700			Eukaryotic aspartyl protease f...		Potri.008G115900 [exp]	1.00	0.9219
AT5G07240		IQD24	IQ-domain 24 (.1)		Potri.012G139800 [exp]	1.41	0.9105
AT5G25510			Protein phosphatase 2A regulat...		Potri.018G073925 [exp]	3.46	0.9021
AT5G53880			unknown protein		Potri.001G398700 [exp]	3.46	0.8891
AT2G22170			Lipase/lipooxygenase, PLAT/LH2...		Potri.005G076900 [exp]	5.09	0.8718
					Potri.016G052301 [exp]	5.29	0.8913
AT1G68350			unknown protein		Potri.010G122600 [exp]	6.00	0.8771
AT4G38660			Pathogenesis-related thaumatin...		Potri.004G173200 [exp]	7.07	0.8756
AT2G18910			hydroxyproline-rich glycoprote...		Potri.006G166400 [exp]	7.74	0.8628
AT2G36830		TIP1;1, GAMMA-T...	TONOPLAST INTRINSIC PROTEIN 1;...		Potri.006G121700 [exp]	9.48	0.8896	Pt-TIP2.7

Compare expression of checked genes

Potri.012G065750 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.