Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G19000 147 / 2e-41 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT3G19010 144 / 4e-40 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.3) AT5G08640 142 / 7e-40 ATFLS1, FLS flavonol synthase 1 (.1.2) AT3G11180 137 / 2e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT4G16330 137 / 2e-37 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) AT5G24530 134 / 1e-36 DMR6 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT4G10490 129 / 1e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT5G63590 127 / 2e-34 ATFLS3, FLS3, FLS flavonol synthase 3 (.1) AT5G05600 128 / 5e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) AT2G38240 127 / 5e-34 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.011G150100 [exp] 149 / 3e-42 AT4G10490 501 / 2e-179 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.012G006300 [exp] 145 / 7e-41 AT5G24530 506 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.001G451900 [exp] 144 / 4e-40 AT4G10490 498 / 3e-178 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.015G002800 [exp] 143 / 4e-40 AT5G24530 521 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.014G106700 [exp] 139 / 2e-38 AT4G10490 468 / 2e-166 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Potri.004G139700 [exp] 138 / 2e-38 AT5G08640 446 / 3e-158 flavonol synthase 1 (.1.2) Potri.019G014454 [exp] 137 / 9e-38 AT5G08640 454 / 1e-161 flavonol synthase 1 (.1.2) Potri.009G107600 [exp] 135 / 3e-37 AT3G19000 459 / 4e-163 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Potri.004G146100 [exp] 135 / 1e-36 AT3G19000 374 / 5e-129 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10023602 [exp] 389 / 5e-136 AT3G11180 158 / 5e-45 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10024230 [exp] 370 / 5e-129 AT3G19000 149 / 3e-42 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10031150 [exp] 201 / 7e-63 AT4G10490 114 / 1e-29 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10030185 [exp] 142 / 1e-39 AT4G10490 442 / 3e-156 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10023851 [exp] 140 / 7e-39 AT3G19000 474 / 9e-169 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1), 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.2) Lus10015573 [exp] 139 / 2e-38 AT5G24530 510 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10024882 [exp] 138 / 5e-38 AT5G24530 271 / 2e-89 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10032930 [exp] 137 / 1e-37 AT5G24530 504 / 0.0 DOWNY MILDEW RESISTANT 6, 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein (.1) Lus10040112 [exp] 137 / 1e-37 AT1G17020 332 / 1e-112 senescence-related gene 1 (.1) Lus10030934 [exp] 136 / 3e-37 AT1G17020 337 / 2e-114 senescence-related gene 1 (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0029 [poplar] [flax] Cupin PF03171 [poplar] [flax] 2OG-FeII_Oxy 2OG-Fe(II) oxygenase superfamily CL0029 [poplar] [flax] Cupin PF14226 [poplar] [flax] DIOX_N non-haem dioxygenase in morphine synthesis N-terminal
Representative CDS sequence Show only first row Show all	>Potri.012G069200.1 pacid=42784269 polypeptide=Potri.012G069200.1.p locus=Potri.012G069200 ID=Potri.012G069200.1.v4.1 annot-version=v4.1 ATGGGTGAGTCTTGCATTCCTACTGTCGATCTCTCACCTTGCTTCCGAGAAGATGATGAGGATGGCATGAAGAAAGCCAAAGAAATTATCGGTCAAGCTT GTTCCGAGTATGGATTCTTCCAAGTGGTGAATCATGGTGTTCCGCTTGGTTTGATGACGCGAGCCATCGAGCTTTCCAAAACATTTTTCGAGACGTTGCC GAATGAGGAGAAGCTCAAATGTGTTCCTAATTCTGGTGCTCCCCTTCCGGCTGGTTATAACAGGCAACCAGAACAATCGCCAGACAAGAACGAGTATTTA TTGATGTTTCCACCAGCCTCTAACTTGAATGTTTACCCACAAAACCCTCCTCATTTTAGGGAGGTATTGGAACAGATATTCGCTTACTTTACTAAGCTAG GTGTGCTTATTGAGAGCATATTAAGCCAGTGTTTAGGTCTCCCTTCCAACTTCCTCAAGGAATTCAATCACGACAGGAGCTGGGATTTCATGGCAGGCTT GCATTATTTCCCTGCAACCGAAGCTGAAAACAACGGAATCACTGAGCACGAAGACGGGAATTGCATCACTTTTGTTTTCCAGGATGAAGCTGGAGGCTTA GAAGTTCGCAGAAATGGGAAATGGATTCCAGTCATTCCTACGAGGGGCTCATTAGTAGTCAACGTTGGCGATGTTATTCAGGTATTGAGCAACAATAATT TCAAGAGCGCAACGCACAGGGTGGTGAGACCGAAATCCAAAAGTCGATATTCATACGCCTTCTTTTATAACTTGCACGGAGACAAGTGGGTTGAGCCCCT GCAGCAGTTTACGAAAGACATCGGAGAGGCACCCAAGTATAGAGGTTTCCGGTACAAAGAGTACCAGGAGCTGAGAATGAGAAACAAGACCCATCCACCG TCAACGCCTGAAGACGTGATTCGCATAACCCATTATGCACTCAATACCTCTTAA
AA sequence Show only first row Show all	>Potri.012G069200.1 pacid=42784269 polypeptide=Potri.012G069200.1.p locus=Potri.012G069200 ID=Potri.012G069200.1.v4.1 annot-version=v4.1 MGESCIPTVDLSPCFREDDEDGMKKAKEIIGQACSEYGFFQVVNHGVPLGLMTRAIELSKTFFETLPNEEKLKCVPNSGAPLPAGYNRQPEQSPDKNEYL LMFPPASNLNVYPQNPPHFREVLEQIFAYFTKLGVLIESILSQCLGLPSNFLKEFNHDRSWDFMAGLHYFPATEAENNGITEHEDGNCITFVFQDEAGGL EVRRNGKWIPVIPTRGSLVVNVGDVIQVLSNNNFKSATHRVVRPKSKSRYSYAFFYNLHGDKWVEPLQQFTKDIGEAPKYRGFRYKEYQELRMRNKTHPP STPEDVIRITHYALNTS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G19000			2-oxoglutarate (2OG) and Fe(II...		Potri.012G069200 [exp]	0	1
AT1G22640	MYB	AtMYB3	ARABIDOPSIS THALIANA MYB DOMA...		Potri.003G144300 [exp]	2.00	0.9663	MYB153
AT4G30170			Peroxidase family protein (.1)		Potri.018G089900 [exp]	2.23	0.9761
AT5G07010		ATST2A	ARABIDOPSIS THALIANA SULFOTRAN...		Potri.001G036700 [exp]	3.74	0.9677
AT2G21045			Rhodanese/Cell cycle control p...		Potri.014G131300 [exp]	4.58	0.9666
AT2G01340		At17.1	unknown protein		Potri.010G113800 [exp]	5.83	0.9464
					Potri.001G405600 [exp]	9.21	0.9642
AT5G10190			Major facilitator superfamily ...		Potri.007G091700 [exp]	9.38	0.9519
AT1G14920	GRAS	RGA2, GAI	RESTORATION ON GROWTH ON AMMON...		Potri.016G027800 [exp]	13.22	0.9618
AT1G68940			Armadillo/beta-catenin-like re...		Potri.010G136500 [exp]	13.85	0.9633
AT5G50300		ATAZG2	ARABIDOPSIS THALIANA AZA-GUANI...		Potri.015G090000 [exp]	14.69	0.9567

Compare expression of checked genes

Potri.012G069200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.