Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol	ATHVA22.1
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74520 258 / 2e-89 ATHVA22A HVA22 homologue A (.1) AT1G69700 200 / 4e-66 ATHVA22C HVA22 homologue C (.1) AT5G62490 189 / 3e-62 ATHVA22B ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) AT2G42820 134 / 2e-40 HVA22F HVA22-like protein F (.1) AT5G50720 111 / 5e-32 ATHVA22E ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) AT4G24960 104 / 3e-29 ATHVA22D ARABIDOPSIS THALIANA HVA22 HOMOLOGUE D, HVA22 homologue D (.1.2.3) AT4G36720 61 / 6e-12 HVA22K HVA22-like protein K (.1) AT1G75700 59 / 4e-11 HVA22G HVA22-like protein G (.1) AT5G42560 56 / 1e-09 Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.1), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.2), Abscisic acid-responsive (TB2/DP1, HVA22) family protein (.3) AT1G19950 54 / 6e-09 HVA22H HVA22-like protein H (ATHVA22H) (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G062800 [exp] 307 / 9e-109 AT1G74520 255 / 4e-88 HVA22 homologue A (.1) Potri.001G006000 [exp] 136 / 3e-41 AT2G42820 235 / 1e-80 HVA22-like protein F (.1) Potri.015G099700 [exp] 113 / 1e-32 AT5G50720 166 / 5e-54 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.012G101600 [exp] 112 / 5e-32 AT5G50720 133 / 3e-41 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Potri.014G148600 [exp] 106 / 6e-30 AT5G62490 87 / 1e-22 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE B, HVA22 homologue B (.1) Potri.009G078500 [exp] 113 / 9e-30 AT1G74520 104 / 6e-26 HVA22 homologue A (.1) Potri.017G139000 [exp] 105 / 2e-27 AT1G74520 119 / 5e-32 HVA22 homologue A (.1) Potri.001G283000 [exp] 104 / 2e-26 AT1G74520 98 / 1e-23 HVA22 homologue A (.1) Potri.005G152100 [exp] 102 / 3e-26 AT1G69700 102 / 1e-25 HVA22 homologue C (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042193 [exp] 266 / 3e-86 AT5G39850 327 / 2e-108 Ribosomal protein S4 (.1) Lus10024234 [exp] 251 / 9e-86 AT1G74520 244 / 5e-83 HVA22 homologue A (.1) Lus10023605 [exp] 250 / 1e-85 AT1G74520 246 / 7e-84 HVA22 homologue A (.1) Lus10008623 [exp] 241 / 8e-83 AT1G74520 234 / 5e-80 HVA22 homologue A (.1) Lus10037191 [exp] 240 / 6e-82 AT1G69700 231 / 6e-78 HVA22 homologue C (.1) Lus10031386 [exp] 118 / 3e-34 AT2G42820 246 / 4e-85 HVA22-like protein F (.1) Lus10010944 [exp] 117 / 8e-34 AT2G42820 246 / 7e-85 HVA22-like protein F (.1) Lus10032557 [exp] 112 / 3e-32 AT5G50720 172 / 8e-57 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10043186 [exp] 111 / 1e-31 AT5G50720 169 / 1e-55 ARABIDOPSIS THALIANA HVA22 HOMOLOGUE E, HVA22 homologue E (.1) Lus10010093 [exp] 56 / 8e-10 AT4G36720 202 / 2e-66 HVA22-like protein K (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF03134 [poplar] [flax] TB2_DP1_HVA22 TB2/DP1, HVA22 family
Representative CDS sequence Show only first row Show all	>Potri.012G069300.1 pacid=42782925 polypeptide=Potri.012G069300.1.p locus=Potri.012G069300 ID=Potri.012G069300.1.v4.1 annot-version=v4.1 ATGGGATCTGGGACTGGAAGCTTCTTCAAGGTTCTTCTTAAGAACTTCGACGTTCTTTCTGGGCCTGTGGTTAGTCTTGTTTATCCTCTGTATGCATCAA TTAGGGCAATTGAGACTAAATCTCACGTTGATGATAAGCAATGGCTTACTTACTGGATTCTTTACTCAATGATCACACTCTTCGAGCTTACCTTTGCCAA AGTCATTGAGTGGATACCAATCTGGCCATATGCGAGGCTCATTTTGACCTGCTGGTTGGTCATTCCATACTTCAGTGGTGCTGCATATGTTTATGAGAAT TTTGTGAGACCTTTCTTTGCCAACCCACAGCAAACCCTTAATATATGGTATGTCCCAAGAAAGAAGGATGTCTTCAGCAAACCAGATGACGTTCTAACTG CTGCTGAGAAATACATCGAAGAGAATGGAACTTCTGCTTTTGAGAAGCTCATTACCAAGGGTAAATCCAAGAGGCGTAGCTTATTCGATGATGAGGATGA CCGATACTGA
AA sequence Show only first row Show all	>Potri.012G069300.1 pacid=42782925 polypeptide=Potri.012G069300.1.p locus=Potri.012G069300 ID=Potri.012G069300.1.v4.1 annot-version=v4.1 MGSGTGSFFKVLLKNFDVLSGPVVSLVYPLYASIRAIETKSHVDDKQWLTYWILYSMITLFELTFAKVIEWIPIWPYARLILTCWLVIPYFSGAAYVYEN FVRPFFANPQQTLNIWYVPRKKDVFSKPDDVLTAAEKYIEENGTSAFEKLITKGKSKRRSLFDDEDDRY

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G74520		ATHVA22A	HVA22 homologue A (.1)		Potri.012G069300 [exp]	0	1	ATHVA22.1
AT2G39770		VTC1, SOZ1, GMP...	VITAMIN C DEFECTIVE 1, SENSITI...		Potri.008G060100 [exp]	8.48	0.8176	Pt-EMB101.2
AT4G15800		RALFL33	ralf-like 33 (.1)		Potri.013G017400 [exp]	9.00	0.7818	Pt-RALFL23.3
AT4G10590		UBP10	ubiquitin-specific protease 10...		Potri.016G067400 [exp]	9.69	0.8537
AT5G27690			Heavy metal transport/detoxifi...		Potri.002G206900 [exp]	9.79	0.8258
AT1G55210			Disease resistance-responsive ...		Potri.003G216200 [exp]	9.89	0.7987
AT2G02850		ARPN	plantacyanin (.1)		Potri.001G209300 [exp]	11.22	0.8479	Pt-BABL.1
					Potri.012G078600 [exp]	11.48	0.7701
AT1G08390			unknown protein		Potri.004G190200 [exp]	15.19	0.7923
AT3G24820			BSD domain-containing protein ...		Potri.002G242200 [exp]	25.63	0.7928
AT5G59480			Haloacid dehalogenase-like hyd...		Potri.001G242300 [exp]	28.80	0.7523

Compare expression of checked genes

Potri.012G069300 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.