Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G62740 484 / 5e-175 AtHIR4, ATHIR1 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) AT1G69840 458 / 1e-164 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7) AT3G01290 438 / 1e-156 AtHIR2 hypersensitive induced reaction 2, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) AT5G51570 321 / 2e-110 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) AT5G54100 51 / 4e-07 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) AT4G27585 45 / 2e-05 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.017G078100 [exp] 491 / 1e-177 AT5G62740 488 / 3e-176 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.017G078000 [exp] 456 / 5e-164 AT5G62740 518 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.015G065001 [exp] 327 / 9e-114 AT5G62740 312 / 4e-108 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.015G130600 [exp] 323 / 4e-111 AT5G51570 510 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.012G129000 [exp] 309 / 7e-106 AT5G51570 480 / 4e-173 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Potri.012G005500 [exp] 50 / 8e-07 AT4G27585 463 / 3e-162 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10033099 [exp] 490 / 3e-177 AT5G62740 533 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10004268 [exp] 486 / 9e-176 AT5G62740 535 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10007268 [exp] 479 / 5e-173 AT5G62740 510 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10015356 [exp] 476 / 1e-171 AT5G62740 506 / 0.0 hypersensitive induced reaction 4, HYPERSENSITIVE-INDUCED RESPONSE PROTEIN 1, SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10037213 [exp] 457 / 2e-164 AT1G69840 514 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7) Lus10036715 [exp] 456 / 9e-164 AT1G69840 516 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1.2.3.4.5.6.7) Lus10038907 [exp] 303 / 2e-103 AT5G51570 529 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10015032 [exp] 302 / 5e-103 AT5G51570 532 / 0.0 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1) Lus10032909 [exp] 50 / 1e-06 AT4G27585 498 / 4e-176 SPFH/Band 7/PHB domain-containing membrane-associated protein family (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0433 [poplar] [flax] SPFH PF01145 [poplar] [flax] Band_7 SPFH domain / Band 7 family
Representative CDS sequence Show only first row Show all	>Potri.012G070500.2 pacid=42782845 polypeptide=Potri.012G070500.2.p locus=Potri.012G070500 ID=Potri.012G070500.2.v4.1 annot-version=v4.1 ATGGGTAATCTGTGTTGTTGCGTACAAGTTGATCAGTCTTCAGTAGCTATAAAGGAGACATTTGGAAAGTTTGAAGCAGTTCTTGATCCTGGATGTCATT GCCTTCCTTGGTTCCTTGGAAGCCAGCTCGCAGGCCATCTGTCTCTGAGGTTGCAGCAGTTGGATGTCCGATGTGAGACCAAGACGAAGGACAACGTTTT TGTCAATGTTGTTGCATCTATTCAATACCGTGCCCTGGCAGACAAGGCAAGTGATGCTTTCTACAAACTAACCAACACAAGGACTCAAATCCAGGCCTAT GTTTTTGATGTAATAAGGGCCAGTGTCCCAAAACTTAATCTCGATGATGTGTTTGAGCAGAAGAATGAGATAGCCAAAGCTGTGGAAGATGAACTTGGAA AGGCCATGTCTGCTTATGGATATGAGATTGTGCAAACGCTCATTGTTGATATAGAACCAGATGAGCATGTGAAGCGGGCAATGAATGAGATCAATGCAGC TGCAAGACTGAGATTGGCGGCTAATGAGAAGGCAGAGGCTGAGAAGATTCTACAAATCAAGAGAGCTGAGGGTGAGGCTGAATCAAAGTATCTCTCTGGG CTGGGTATTGCTCGCCAGCGACAAGCAATTGTGGATGGCTTGAGAGATAGCGTGTTGGGCTTCTCTGAGAATGTGCCAGGGACCTCTGCAAAGGATGTCA TGGACATGGTCCTGGTCACCCAGTACTTCGACACAATGAAGGAAATCGGTGCTGCCTCAAAATCCTCTGCTGTGTTTATTCCTCATGGACCTGGTGCTAT TCGTGATGTTGCTACTCAGATTCGAGATGGACTTCTTCAGGCTTCGGCCCACAAGTAA
AA sequence Show only first row Show all	>Potri.012G070500.2 pacid=42782845 polypeptide=Potri.012G070500.2.p locus=Potri.012G070500 ID=Potri.012G070500.2.v4.1 annot-version=v4.1 MGNLCCCVQVDQSSVAIKETFGKFEAVLDPGCHCLPWFLGSQLAGHLSLRLQQLDVRCETKTKDNVFVNVVASIQYRALADKASDAFYKLTNTRTQIQAY VFDVIRASVPKLNLDDVFEQKNEIAKAVEDELGKAMSAYGYEIVQTLIVDIEPDEHVKRAMNEINAAARLRLAANEKAEAEKILQIKRAEGEAESKYLSG LGIARQRQAIVDGLRDSVLGFSENVPGTSAKDVMDMVLVTQYFDTMKEIGAASKSSAVFIPHGPGAIRDVATQIRDGLLQASAHK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G62740		AtHIR4, ATHIR1	hypersensitive induced reactio...		Potri.012G070500 [exp]	0	1
AT5G48520		AtAUG3	augmin 3, unknown protein		Potri.014G191100 [exp]	3.46	0.8954
AT4G27880			Protein with RING/U-box and TR...		Potri.012G015500 [exp]	4.69	0.9057	SINAT4.2
AT1G32460			unknown protein		Potri.001G145066 [exp]	4.89	0.8697
AT5G18940			Mo25 family protein (.1.2)		Potri.010G028700 [exp]	7.74	0.8834
AT5G18940			Mo25 family protein (.1.2)		Potri.008G198900 [exp]	8.83	0.8655
					Potri.008G100650 [exp]	9.00	0.8213
AT1G55300		TAF7	TBP-associated factor 7 (.1.2)		Potri.001G006300 [exp]	9.05	0.8370
AT1G32540		LOL1	lsd one like 1 (.1.2.3)		Potri.003G090300 [exp]	10.09	0.8314
AT3G52120			SWAP (Suppressor-of-White-APri...		Potri.001G269900 [exp]	13.96	0.8389
AT1G71190		TTN4, SAG18	senescence associated gene 18 ...		Potri.001G211600 [exp]	15.49	0.8577

Compare expression of checked genes

Potri.012G070500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.