Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G74780 166 / 3e-49 Nodulin-like / Major Facilitator Superfamily protein (.1) AT2G34350 150 / 2e-43 Nodulin-like / Major Facilitator Superfamily protein (.1) AT2G34355 149 / 8e-43 Major facilitator superfamily protein (.1) AT1G18940 149 / 1e-42 Nodulin-like / Major Facilitator Superfamily protein (.1) AT2G39210 102 / 9e-26 Major facilitator superfamily protein (.1) AT2G28120 95 / 5e-23 Major facilitator superfamily protein (.1) AT5G14120 88 / 1e-20 Major facilitator superfamily protein (.1) AT3G01930 86 / 9e-20 Major facilitator superfamily protein (.1.2) AT5G50520 82 / 1e-18 Major facilitator superfamily protein (.1) AT5G50630 82 / 1e-18 Major facilitator superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G067000 [exp] 150 / 4e-43 AT1G74780 562 / 0.0 Nodulin-like / Major Facilitator Superfamily protein (.1) Potri.006G122400 [exp] 102 / 2e-25 AT2G39210 767 / 0.0 Major facilitator superfamily protein (.1) Potri.001G194500 [exp] 98 / 2e-25 AT2G28120 377 / 9e-130 Major facilitator superfamily protein (.1) Potri.004G215600 [exp] 100 / 1e-24 AT2G28120 810 / 0.0 Major facilitator superfamily protein (.1) Potri.009G006400 [exp] 98 / 4e-24 AT2G28120 845 / 0.0 Major facilitator superfamily protein (.1) Potri.002G133900 [exp] 92 / 5e-22 AT2G39210 666 / 0.0 Major facilitator superfamily protein (.1) Potri.008G032901 [exp] 92 / 6e-22 AT2G39210 830 / 0.0 Major facilitator superfamily protein (.1) Potri.001G329100 [exp] 90 / 3e-21 AT3G01930 869 / 0.0 Major facilitator superfamily protein (.1.2) Potri.017G064201 [exp] 85 / 2e-19 AT3G01930 805 / 0.0 Major facilitator superfamily protein (.1.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042170 [exp] 187 / 6e-57 AT1G74780 566 / 0.0 Nodulin-like / Major Facilitator Superfamily protein (.1) Lus10033115 [exp] 159 / 1e-46 AT1G74780 619 / 0.0 Nodulin-like / Major Facilitator Superfamily protein (.1) Lus10036663 [exp] 144 / 9e-41 AT1G74780 520 / 0.0 Nodulin-like / Major Facilitator Superfamily protein (.1) Lus10014640 [exp] 108 / 8e-28 AT2G39210 728 / 0.0 Major facilitator superfamily protein (.1) Lus10033790 [exp] 108 / 1e-27 AT2G39210 734 / 0.0 Major facilitator superfamily protein (.1) Lus10025123 [exp] 93 / 3e-22 AT5G14120 674 / 0.0 Major facilitator superfamily protein (.1) Lus10021513 [exp] 93 / 3e-22 AT2G39210 587 / 0.0 Major facilitator superfamily protein (.1) Lus10022614 [exp] 92 / 6e-22 AT2G39210 652 / 0.0 Major facilitator superfamily protein (.1) Lus10038682 [exp] 90 / 4e-21 AT2G39210 829 / 0.0 Major facilitator superfamily protein (.1) Lus10037948 [exp] 89 / 1e-20 AT2G39210 839 / 0.0 Major facilitator superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0015 [poplar] [flax] MFS PF06813 [poplar] [flax] Nodulin-like Nodulin-like
Representative CDS sequence Show only first row Show all	>Potri.012G072101.1 pacid=42783343 polypeptide=Potri.012G072101.1.p locus=Potri.012G072101 ID=Potri.012G072101.1.v4.1 annot-version=v4.1 ATGGTTCTCTACAGTAGCGAGCATATGGATTCAGTGCACCAGCGGTTCTCTCTACACCTTCTCCATCTACTCTCCAACTCTCAAATCCACTCAAGCTTAT CAACACTCGACACCGTATCTGATATCGGTGCCGACTGCGGAGTCCTCTCTGGTGTTCTCTACACCTCTGCCACGTCCTGGAATCAAAGCAGAGTTCGTGG TGGGCCATGGGTTGTTCTCGTGGCTGGCGCGATTCAGTGTTTCGCGGGCTATTTTTCTACGTGGGCTGCTGTTACTGGTTTGATTCCTCGACCGCCGGTT GCGGCGATGTGTCTGTTCGTGTTTGTAGCCGCACATGCCCAGAGTTTCTTTAACACCGCCGATGTTGTCACCTCTGTAAGGAATTTCCGTCACTTTAGTG ACACTGCCGTTGGCATCATGAAGGGATTTCTTGGTTTGAGTGGGGCAATACTAATTCAAGCATACCAAACCATATTCAGCAGCAAACCCAGCCGGTATCT CTTGACGTTGGCAATTTTGACAAGAACCAAGTAA
AA sequence Show only first row Show all	>Potri.012G072101.1 pacid=42783343 polypeptide=Potri.012G072101.1.p locus=Potri.012G072101 ID=Potri.012G072101.1.v4.1 annot-version=v4.1 MVLYSSEHMDSVHQRFSLHLLHLLSNSQIHSSLSTLDTVSDIGADCGVLSGVLYTSATSWNQSRVRGGPWVVLVAGAIQCFAGYFSTWAAVTGLIPRPPV AAMCLFVFVAAHAQSFFNTADVVTSVRNFRHFSDTAVGIMKGFLGLSGAILIQAYQTIFSSKPSRYLLTLAILTRTK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G74780			Nodulin-like / Major Facilitat...		Potri.012G072101 [exp]	0	1
					Potri.005G193600 [exp]	2.82	0.9191
AT3G16360		AHP4	HPT phosphotransmitter 4 (.1.2...		Potri.006G236300 [exp]	4.89	0.9115
AT2G29090		CYP707A2	"cytochrome P450, family 707, ...		Potri.001G242600 [exp]	7.07	0.8689
AT3G60530	GATA	GATA4	GATA transcription factor 4 (....		Potri.002G142800 [exp]	7.93	0.8797
AT5G05340			Peroxidase superfamily protein...		Potri.014G143200 [exp]	15.49	0.8829	Pt-PRX1.11
					Potri.016G031166 [exp]	17.34	0.8881
AT3G18440		ATALMT9	aluminum-activated malate tran...		Potri.001G097300 [exp]	21.26	0.8896
AT1G67540			unknown protein		Potri.008G177300 [exp]	24.89	0.8222
AT5G28010			Polyketide cyclase/dehydrase a...		Potri.004G051500 [exp]	25.23	0.8043
AT2G30600			BTB/POZ domain-containing prot...		Potri.005G251300 [exp]	27.98	0.8408

Compare expression of checked genes

Potri.012G072101 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.