Potri.012G073800 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues

No hit found

Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G068800 177 / 3e-58 ND /
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10033126 108 / 1e-30 ND /
Lus10036653 109 / 2e-28 AT3G08720 515 / 1e-178 ARABIDOPSIS THALIANA SERINE/THREONINE PROTEIN KINASE 2, ARABIDOPSIS THALIANA PROTEIN KINASE 2, Arabidopsis thaliana protein kinase 19, serine/threonine protein kinase 2 (.1.2)
PFAM info
Representative CDS sequence
>Potri.012G073800.2 pacid=42784368 polypeptide=Potri.012G073800.2.p locus=Potri.012G073800 ID=Potri.012G073800.2.v4.1 annot-version=v4.1
ATGAGTAGCAAAAATAGGAGCAACAATTCCCTCTGTGAGAACTCAATGAAGGTGGCGGTGAACATCATAAAATTGTCTTCATTTTCTATTGCTAAGATGA
GTCTGGGAACACATAGTCCTCCAGTTGTCACCAAAAGTTATATCCCTATGACAGGCTCGGTCATGGTTGCTAATGAACCATTGTTGTCTCAAATTCCAGG
AAGTCGAAGGTCACAAGAGTCACAGGGGAGCTCAAAGCCAATATCATTTGTGATGCAGCCAGATGAAGGTAATGGTTCTACACATGCGATCCACAAGGAG
AACAGTGTTATAGATGGGAGGGCTTCTGATTATATCAGAAAGGTACACGAGAAAAACCACAAAGATGCTCGTGAGATGTCAGAACTCTCCTCGTACATAC
TACCTCCTCCGCCATGA
AA sequence
>Potri.012G073800.2 pacid=42784368 polypeptide=Potri.012G073800.2.p locus=Potri.012G073800 ID=Potri.012G073800.2.v4.1 annot-version=v4.1
MSSKNRSNNSLCENSMKVAVNIIKLSSFSIAKMSLGTHSPPVVTKSYIPMTGSVMVANEPLLSQIPGSRRSQESQGSSKPISFVMQPDEGNGSTHAIHKE
NSVIDGRASDYIRKVHEKNHKDAREMSELSSYILPPPP

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
Potri.012G073800 0 1
AT5G02440 unknown protein Potri.001G238900 4.24 0.8228
AT4G35360 Uncharacterised conserved prot... Potri.004G207700 6.92 0.7604
AT3G01980 NAD(P)-binding Rossmann-fold s... Potri.017G067332 7.21 0.8353
AT3G47180 RING/U-box superfamily protein... Potri.005G180300 9.16 0.8182
AT1G09815 POLD4 polymerase delta 4 (.1) Potri.013G076400 9.94 0.8222
AT5G24620 Pathogenesis-related thaumatin... Potri.012G004800 12.68 0.7583
AT5G16290 VAT1 VALINE-TOLERANT 1 (.1.2) Potri.010G178200 13.22 0.7156
AT2G25710 HCS1 holocarboxylase synthase 1 (.1... Potri.005G173000 13.41 0.7327
AT4G31290 ChaC-like family protein (.1) Potri.006G279000 15.16 0.6307
AT2G03500 GARP Homeodomain-like superfamily p... Potri.009G106600 15.87 0.6969

Potri.012G073800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.