Potri.012G076500 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G17690 424 / 1e-149 Peroxidase superfamily protein (.1)
AT5G47000 422 / 7e-149 Peroxidase superfamily protein (.1)
AT5G40150 388 / 2e-135 Peroxidase superfamily protein (.1)
AT1G24110 384 / 6e-134 Peroxidase superfamily protein (.1)
AT3G28200 367 / 1e-127 Peroxidase superfamily protein (.1)
AT5G14130 288 / 4e-96 Peroxidase superfamily protein (.1)
AT4G37530 278 / 3e-92 Peroxidase superfamily protein (.1.2)
AT4G37520 272 / 5e-90 Peroxidase superfamily protein (.1.2)
AT5G67400 270 / 5e-89 RHS19 root hair specific 19 (.1)
AT3G49960 261 / 2e-85 Peroxidase superfamily protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.010G036100 436 / 2e-154 AT1G24110 400 / 2e-140 Peroxidase superfamily protein (.1)
Potri.001G351000 409 / 7e-144 AT3G28200 448 / 2e-159 Peroxidase superfamily protein (.1)
Potri.007G074700 363 / 1e-125 AT5G47000 358 / 8e-124 Peroxidase superfamily protein (.1)
Potri.007G053400 283 / 2e-94 AT5G67400 471 / 4e-168 root hair specific 19 (.1)
Potri.017G064100 281 / 2e-93 AT5G67400 372 / 2e-129 root hair specific 19 (.1)
Potri.001G329200 274 / 1e-90 AT4G37530 392 / 4e-137 Peroxidase superfamily protein (.1.2)
Potri.004G052100 273 / 4e-90 AT2G34060 458 / 1e-162 Peroxidase superfamily protein (.1)
Potri.018G089900 261 / 7e-86 AT4G30170 472 / 6e-169 Peroxidase family protein (.1)
Potri.011G062300 258 / 7e-84 AT2G34060 434 / 1e-152 Peroxidase superfamily protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10010716 427 / 5e-151 AT1G24110 407 / 4e-143 Peroxidase superfamily protein (.1)
Lus10004234 422 / 1e-148 AT1G24110 391 / 1e-136 Peroxidase superfamily protein (.1)
Lus10042144 419 / 1e-147 AT1G24110 390 / 2e-136 Peroxidase superfamily protein (.1)
Lus10039445 394 / 5e-138 AT5G40150 467 / 8e-167 Peroxidase superfamily protein (.1)
Lus10029201 315 / 2e-108 AT1G24110 288 / 6e-98 Peroxidase superfamily protein (.1)
Lus10011079 283 / 7e-94 AT4G37530 479 / 2e-171 Peroxidase superfamily protein (.1.2)
Lus10012540 276 / 3e-91 AT5G14130 384 / 5e-134 Peroxidase superfamily protein (.1)
Lus10001442 272 / 6e-90 AT4G30170 475 / 7e-170 Peroxidase family protein (.1)
Lus10013955 263 / 3e-85 AT2G34060 451 / 1e-158 Peroxidase superfamily protein (.1)
Lus10032035 249 / 8e-81 AT5G67400 394 / 3e-138 root hair specific 19 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0617 Peroxidase PF00141 peroxidase Peroxidase
Representative CDS sequence
>Potri.012G076500.1 pacid=42783796 polypeptide=Potri.012G076500.1.p locus=Potri.012G076500 ID=Potri.012G076500.1.v4.1 annot-version=v4.1
ATGGCTTTCCCTCTGCGTATTCTTCTGCTTCTCTTCCTCTCCATTCCTTTCTCAGAGTCGAAGTCCAATCTCTCCTTTGATTACTACAAGAGATCATGCC
CTAACTTCGAAAAGATTGTTCGTGAAACCATCACCACCAAACAAATGAGCAACCCTGCAACCGCGGCCGGCACTCTACGTCTCTTCTTCCATGACTGCAT
GGTTGAGGGATGTGATGCCTCGGTTTTCATAGCATCAAACTCATTCAACACCGCCGAGCGCGATGCAGACGTTAACCTCTCCCTGTCAGGGGATGGCTAC
GAGGTGGTGATTAAGGCAAAGACTACACTTGAGCTAACTTGCCCTAAAGTCGTCTCCTGCGCGGACATCCTTGCAGTGGCCACACGTGATCTTGTCACCA
TGGTTGGAGGACCTTATTACAAAATCCGACTAGGAAGGAAGGATGGTTTGGTCTCTAAGGCCTCCAGGGTAGAGGGAAATCTCCCCAGGAGCAACATGAG
TATGACCCATGTGATCAATTTGTTTGCCTCCAAAGGATTCAATGTTCAAGAAATGGTTGCATTAACAGGTGGTCACACCATTGGATTCTCTCATTGCATT
GAATTCTCCGATAGGCTATTTAGTTACAGCAAGAAACAAGCAACTGATCCTGAACTCAACTCCAAGTTTGCAGCCGGATTGAGAAATATCTGTGCTAATC
ACACCACAGATAAAACCATGTCGGCCTTCAATGATGTGTTTACGCCAGGCAAGTTTGATAATATGTATTTCAAGAACTTGCCTAGGGGGCTGGGGCTTTT
GGCATATGATCATGCCCTTGTTAAGGACCCAAGAACTAAGCCTTTTGTGGAGCTTTATGCAACAAACCAGACAGTTTTCTTCCAGGATTTCTCTCGTGCA
ATGCAGAAGCTTAGCATTCATGGGATCAAGACTGCAATAAACGGAGAAGTGAGGAATAGGTGCGATCAGTTCAATTCAATCCAGACTTAG
AA sequence
>Potri.012G076500.1 pacid=42783796 polypeptide=Potri.012G076500.1.p locus=Potri.012G076500 ID=Potri.012G076500.1.v4.1 annot-version=v4.1
MAFPLRILLLLFLSIPFSESKSNLSFDYYKRSCPNFEKIVRETITTKQMSNPATAAGTLRLFFHDCMVEGCDASVFIASNSFNTAERDADVNLSLSGDGY
EVVIKAKTTLELTCPKVVSCADILAVATRDLVTMVGGPYYKIRLGRKDGLVSKASRVEGNLPRSNMSMTHVINLFASKGFNVQEMVALTGGHTIGFSHCI
EFSDRLFSYSKKQATDPELNSKFAAGLRNICANHTTDKTMSAFNDVFTPGKFDNMYFKNLPRGLGLLAYDHALVKDPRTKPFVELYATNQTVFFQDFSRA
MQKLSIHGIKTAINGEVRNRCDQFNSIQT

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G17690 Peroxidase superfamily protein... Potri.012G076500 0 1
AT5G22900 ATCHX3 cation/H+ exchanger 3, ARABIDO... Potri.018G098300 2.64 0.6934 Pt-ATCHX3.2
AT5G05800 unknown protein Potri.004G230401 3.00 0.6839
Potri.016G095001 3.46 0.6779
AT5G10490 MSL2 MSCS-like 2 (.1.2.3) Potri.005G107200 5.91 0.6704
AT2G28100 ATFUC1 alpha-L-fucosidase 1 (.1) Potri.015G133500 7.48 0.6208
Potri.005G022200 19.18 0.5224
Potri.006G226200 23.62 0.6179
AT5G44440 FAD-binding Berberine family p... Potri.011G158000 24.24 0.6371
AT5G62380 NAC ANAC101, VND6 VASCULAR-RELATED NAC-DOMAIN 6,... Potri.014G163600 30.29 0.5441
AT1G64940 CYP89A6 "cytochrome P450, family 87, s... Potri.003G104600 33.76 0.5881

Potri.012G076500 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.