Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G18420 85 / 9e-23 Gibberellin-regulated family protein (.1) AT5G14920 88 / 3e-22 Gibberellin-regulated family protein (.1.2) AT4G09600 82 / 1e-21 GASA3 GAST1 protein homolog 3 (.1) AT1G75750 82 / 1e-21 GASA1 GAST1 protein homolog 1 (.1.2) AT1G22690 79 / 3e-20 Gibberellin-regulated family protein (.1.2.3) AT4G09610 63 / 3e-14 GASA2 GAST1 protein homolog 2 (.1) AT1G74670 56 / 3e-11 GASA6 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1) AT2G39540 53 / 3e-10 Gibberellin-regulated family protein (.1) AT1G10588 51 / 1e-09 Gibberellin-regulated family protein (.1.2) AT5G59845 50 / 2e-09 Gibberellin-regulated family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G071500 [exp] 203 / 1e-69 AT5G14920 90 / 5e-23 Gibberellin-regulated family protein (.1.2) Potri.002G022500 [exp] 98 / 1e-27 AT2G18420 99 / 2e-28 Gibberellin-regulated family protein (.1) Potri.001G350600 [exp] 96 / 2e-25 AT5G14920 103 / 1e-26 Gibberellin-regulated family protein (.1.2) Potri.002G022600 [exp] 90 / 1e-24 AT1G75750 110 / 4e-33 GAST1 protein homolog 1 (.1.2) Potri.005G239000 [exp] 89 / 3e-24 AT2G18420 117 / 6e-36 Gibberellin-regulated family protein (.1) Potri.005G239100 [exp] 87 / 1e-23 AT1G75750 112 / 1e-33 GAST1 protein homolog 1 (.1.2) Potri.002G022700 [exp] 85 / 1e-22 AT1G75750 94 / 1e-26 GAST1 protein homolog 1 (.1.2) Potri.019G083900 [exp] 82 / 2e-21 AT1G22690 103 / 1e-29 Gibberellin-regulated family protein (.1.2.3) Potri.013G113400 [exp] 76 / 3e-19 AT2G18420 96 / 2e-27 Gibberellin-regulated family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10039443 [exp] 96 / 3e-26 AT5G14920 103 / 2e-27 Gibberellin-regulated family protein (.1.2) Lus10017212 [exp] 90 / 7e-25 AT1G75750 107 / 3e-32 GAST1 protein homolog 1 (.1.2) Lus10034524 [exp] 90 / 1e-24 AT1G75750 94 / 3e-26 GAST1 protein homolog 1 (.1.2) Lus10033145 [exp] 80 / 1e-20 AT1G75750 81 / 2e-21 GAST1 protein homolog 1 (.1.2) Lus10009421 [exp] 78 / 4e-19 AT1G22690 90 / 1e-23 Gibberellin-regulated family protein (.1.2.3) Lus10014262 [exp] 73 / 7e-18 AT4G09600 86 / 7e-23 GAST1 protein homolog 3 (.1) Lus10025962 [exp] 73 / 8e-18 AT4G09600 87 / 1e-23 GAST1 protein homolog 3 (.1) Lus10021098 [exp] 68 / 3e-16 AT2G18420 77 / 8e-20 Gibberellin-regulated family protein (.1) Lus10024338 [exp] 67 / 2e-15 ND 78 / 3e-20 Lus10042203 [exp] 55 / 8e-11 AT1G74670 138 / 6e-44 GA-stimulated Arabidopsis 6, Gibberellin-regulated family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF02704 [poplar] [flax] GASA Gibberellin regulated protein
Representative CDS sequence Show only first row Show all	>Potri.012G076700.1 pacid=42783350 polypeptide=Potri.012G076700.1.p locus=Potri.012G076700 ID=Potri.012G076700.1.v4.1 annot-version=v4.1 ATGGCAGTACGTTCGCTTCTTGCTATGATGGTTTTGCTTTTCTGCCTTGCTGAGGTATCGTCTGATCTCAAGATAGATACCGAAATACCCCAAGTTTTCC AGCTTGTTGTGAGAGGTGGAAACAGGAGGCTCATGCAAGACATAGATTGTGGAGGGTTATGCAAGCAGAGATGCAGTCTTCACTCAAGGCCTAATCTGTG CAACAGGGCATGTGGCACCTGCTGTGTGAGATGCAAGTGCGTGCCTCCTGGGACCTCAGGGAACAGAGAAGTGTGTGGGACATGCTATACTGACATGACC ACCCATGGGAACAAGACCAAGTGCCCATAG
AA sequence Show only first row Show all	>Potri.012G076700.1 pacid=42783350 polypeptide=Potri.012G076700.1.p locus=Potri.012G076700 ID=Potri.012G076700.1.v4.1 annot-version=v4.1 MAVRSLLAMMVLLFCLAEVSSDLKIDTEIPQVFQLVVRGGNRRLMQDIDCGGLCKQRCSLHSRPNLCNRACGTCCVRCKCVPPGTSGNREVCGTCYTDMT THGNKTKCP

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G18420			Gibberellin-regulated family p...		Potri.012G076700 [exp]	0	1
AT4G16563			Eukaryotic aspartyl protease f...		Potri.001G158600 [exp]	1.41	0.8181
AT4G03210		XTH9, EXGT-A6, ...	xyloglucan endotransglucosylas...		Potri.013G152400 [exp]	1.41	0.7663	Pt-XTH9.2
AT5G14450			GDSL-like Lipase/Acylhydrolase...		Potri.001G342600 [exp]	2.82	0.7509
AT5G54980			Uncharacterised protein family...		Potri.008G052451 [exp]	7.93	0.7649
AT1G70210		ATCYCD1;1, CYCD...	CYCLIN D1;1 (.1)		Potri.007G005700 [exp]	10.95	0.7206
AT3G18670			Ankyrin repeat family protein ...		Potri.011G015750 [exp]	16.27	0.7408
AT2G15320			Leucine-rich repeat (LRR) fami...		Potri.009G097100 [exp]	17.60	0.6665
AT4G31540		ATEXO70G1	exocyst subunit exo70 family p...		Potri.018G008400 [exp]	18.70	0.6157
AT5G03720	HSF	AT-HSFA3	ARABIDOPSIS THALIANA HEAT SHOC...		Potri.006G115700 [exp]	20.78	0.6927
					Potri.001G388001 [exp]	22.64	0.6694

Compare expression of checked genes

Potri.012G076700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.