Potri.012G081700 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT4G22220 253 / 2e-87 ATISU1, ISU1 SufE/NifU family protein (.1)
AT4G04080 227 / 3e-77 ISU3, ATISU3 ISCU-like 3 (.1)
AT3G01020 216 / 5e-73 ISU2, ATISU2 ISCU-like 2 (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G077500 305 / 3e-108 AT4G22220 248 / 3e-85 SufE/NifU family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10042112 246 / 1e-84 AT4G22220 261 / 3e-90 SufE/NifU family protein (.1)
Lus10002383 245 / 5e-84 AT4G22220 260 / 5e-90 SufE/NifU family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0233 SufE_NifU PF01592 NifU_N NifU-like N terminal domain
Representative CDS sequence
>Potri.012G081700.3 pacid=42782659 polypeptide=Potri.012G081700.3.p locus=Potri.012G081700 ID=Potri.012G081700.3.v4.1 annot-version=v4.1
ATGTTGAGACAACTGGCGTCCAAGAGATTGTTCTCCCAAAGAACTCAGATCCTGCCACGCTTCTATCACGAGAAGGTGATTGATCACTTCAACAATCCTC
GCAACGTTGGTTCTTTTGACAAGACAGATCCGACGGTGGGTACTGGGCTTGTCGGCGCACCTGCCTGTGGTGATGTGATGAAGCTGCAGATTAAGGTGGA
TGATACAACTGGTGAGATTATAGATGCTCGATTCAAAACCTTCGGTTGTGGCTCCGCTATTGCTTCCTCCTCTGTTGCTACTGAATGGGTGAAAGGGAAA
CAAATGGAGGAAGTTATGACCATCAAGAACACGGAGATCGCAAAACATCTTTCTCTTCCACCAGTTAAGCTGCACTGCAGCATGCTTGCTGAGGATGCCA
TCAAGGCCGCTGTGAAGGATTATCAAACCAAGCGTGCAAAATCAAATGTTGATTCAGAAGCGGAACCTGCTGTGCAGGCTGCTAAAGCTTGA
AA sequence
>Potri.012G081700.3 pacid=42782659 polypeptide=Potri.012G081700.3.p locus=Potri.012G081700 ID=Potri.012G081700.3.v4.1 annot-version=v4.1
MLRQLASKRLFSQRTQILPRFYHEKVIDHFNNPRNVGSFDKTDPTVGTGLVGAPACGDVMKLQIKVDDTTGEIIDARFKTFGCGSAIASSSVATEWVKGK
QMEEVMTIKNTEIAKHLSLPPVKLHCSMLAEDAIKAAVKDYQTKRAKSNVDSEAEPAVQAAKA

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT4G22220 ATISU1, ISU1 SufE/NifU family protein (.1) Potri.012G081700 0 1
AT3G22840 ELIP1 EARLY LIGHT-INDUCABLE PROTEIN,... Potri.008G158000 3.00 0.9340 ELIP2.1,Elip4
AT3G22840 ELIP1 EARLY LIGHT-INDUCABLE PROTEIN,... Potri.008G158200 4.00 0.9308 Elip1,Pt-ELIP2.2
AT3G22840 ELIP1 EARLY LIGHT-INDUCABLE PROTEIN,... Potri.008G157900 6.24 0.9285
AT3G22840 ELIP1 EARLY LIGHT-INDUCABLE PROTEIN,... Potri.008G157750 8.06 0.9238
AT3G62270 HCO3- transporter family (.1) Potri.012G081800 9.38 0.8846
Potri.012G031150 9.53 0.8973
AT1G75250 MYB RSM3, ATRL6 RADIALIS-LIKE SANT/MYB 3, RAD-... Potri.004G155400 9.79 0.9034
AT4G27130 Translation initiation factor ... Potri.007G122700 10.77 0.8259
AT2G32040 Major facilitator superfamily ... Potri.010G085900 12.24 0.8632
AT4G25810 XTH23, XTR6 xyloglucan endotransglucosylas... Potri.018G094800 12.64 0.8919

Potri.012G081700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.