Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G10650 266 / 2e-87 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT1G60610 232 / 4e-74 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2), SBP (S-ribonuclease binding protein) family protein (.3) AT1G45976 144 / 2e-40 SBP1 S-ribonuclease binding protein 1 (.1) AT5G47050 112 / 1e-28 SBP (S-ribonuclease binding protein) family protein (.1) AT1G79110 108 / 9e-27 BRG2 BOI-related gene 2, zinc ion binding (.1.2) AT4G17680 103 / 1e-25 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT1G32740 103 / 2e-25 SBP (S-ribonuclease binding protein) family protein (.1) AT3G12920 100 / 5e-24 BRG3 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) AT4G35070 93 / 3e-22 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) AT4G19700 94 / 5e-22 BOI, RING Botrytis Susceptible1 Interactor, SBP (S-ribonuclease binding protein) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.010G042200 [exp] 340 / 1e-116 AT1G10650 393 / 2e-137 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.002G124700 [exp] 166 / 1e-48 AT1G45976 378 / 2e-131 S-ribonuclease binding protein 1 (.1) Potri.014G027000 [exp] 165 / 3e-48 AT1G45976 380 / 2e-132 S-ribonuclease binding protein 1 (.1) Potri.001G148600 [exp] 134 / 2e-36 AT1G32740 221 / 4e-70 SBP (S-ribonuclease binding protein) family protein (.1) Potri.003G085800 [exp] 131 / 2e-35 AT1G32740 220 / 9e-70 SBP (S-ribonuclease binding protein) family protein (.1) Potri.015G118000 [exp] 105 / 7e-26 AT5G45100 259 / 2e-85 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Potri.001G439600 [exp] 104 / 2e-25 AT3G12920 256 / 1e-83 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Potri.011G142700 [exp] 99 / 3e-23 AT3G12920 233 / 1e-74 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Potri.012G119200 [exp] 94 / 8e-22 AT5G45100 244 / 1e-79 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10030597 [exp] 311 / 3e-105 AT1G10650 380 / 3e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030599 [exp] 311 / 4e-105 AT1G10650 380 / 4e-132 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10013027 [exp] 298 / 2e-100 AT1G10650 382 / 3e-133 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10030891 [exp] 249 / 6e-82 AT1G10650 275 / 1e-92 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10029136 [exp] 234 / 1e-75 AT1G10650 314 / 7e-107 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10001131 [exp] 157 / 4e-45 AT1G45976 407 / 7e-143 S-ribonuclease binding protein 1 (.1) Lus10031780 [exp] 109 / 3e-27 AT3G12920 260 / 3e-85 BOI-related gene 3, SBP (S-ribonuclease binding protein) family protein (.1) Lus10019790 [exp] 101 / 2e-25 AT4G35070 170 / 1e-53 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10014118 [exp] 101 / 2e-25 AT4G35070 171 / 7e-54 SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2) Lus10018294 [exp] 100 / 9e-24 AT5G45100 266 / 3e-88 BOI-related gene 1, SBP (S-ribonuclease binding protein) family protein (.1), SBP (S-ribonuclease binding protein) family protein (.2)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0229 [poplar] [flax] RING PF13920 [poplar] [flax] zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger)
Representative CDS sequence Show only first row Show all	>Potri.012G082200.2 pacid=42782867 polypeptide=Potri.012G082200.2.p locus=Potri.012G082200 ID=Potri.012G082200.2.v4.1 annot-version=v4.1 ATGTTTGGAGGTAATAACAGCAATCCTTTGGTTCCAATTTCCTTTGGCGAAAACCACATCTTGGATGATGTTAATGCACTGCCTCAGCTGCAGCTACTCG GGGATTATCCAGTTGGGTGCTTTGGGGTCTCTCACACCAGCAATCAGCAGACAGCAATCTTTGGCCAGCCTGCTAAAAGAGTCAATGAGACAGAATCCAT TTCCGGACAGAAAAAGCATCAATTATCATCAAGTAATAACTTCAGCCAATATGATGCCTGTAAATCGGGAATCATTCTGAATCCTAATCATGTATCAATT GGATTGAAACTATCTTGTGAGGAAGATGAACATAACTCTTCTGTTACTTGTACAAGTGAAAGTAATACAGCTACCCTCCCTGTGACGTTGTCTCTCGGTG ATGATCTTAAAGCAGAGATTAATTTGCAGAAAGGGGATTTAGATCAGTATATTAGACTGCAGGAAGAAAATTTCATAAAAGGTGTGAGAGAATTGGGGCA AAGACATACAGTTTCATTGCTGAGTTCCATAGAACAAGGAATTAGCAGCAAGCTACATGAGAAGGAGCTTCAAATGCAAAACATAAACCGCAAGAACAAG GATCTAGTAGAGAGAATAAAGCAAGTTAGCATGGAAGTCCATTCCTGGCACTGCAGAACAAAATATAATGAGTCTGTAGTTAATGTTCTGAAAAGCAATC TGGAGCAAGTAATGGCACAAGGTGCGATGCATGGCAAGGAAGGTTATGGGGACAGTGAGGTCGACACTGCAGCCTCTTATGCTAACCAAAACCATATGCG CCTTGTGGACGGTTCTGCAAATTCAATCTCCTTGAAAAAGCAGATGACTTGCAGAGCTTGCAAGATCAATGAAGCTTCCATCTTGTTATTTCCATGTAGA CACTTGTGCCTCTGCAAAGTTTGTGAAGGGCTCATAGATGTTTGCCCTGTGTGCCGTATAGCGAAGTCTTCAAGTGTTGAAGTGTTTCTGTCCTAA
AA sequence Show only first row Show all	>Potri.012G082200.2 pacid=42782867 polypeptide=Potri.012G082200.2.p locus=Potri.012G082200 ID=Potri.012G082200.2.v4.1 annot-version=v4.1 MFGGNNSNPLVPISFGENHILDDVNALPQLQLLGDYPVGCFGVSHTSNQQTAIFGQPAKRVNETESISGQKKHQLSSSNNFSQYDACKSGIILNPNHVSI GLKLSCEEDEHNSSVTCTSESNTATLPVTLSLGDDLKAEINLQKGDLDQYIRLQEENFIKGVRELGQRHTVSLLSSIEQGISSKLHEKELQMQNINRKNK DLVERIKQVSMEVHSWHCRTKYNESVVNVLKSNLEQVMAQGAMHGKEGYGDSEVDTAASYANQNHMRLVDGSANSISLKKQMTCRACKINEASILLFPCR HLCLCKVCEGLIDVCPVCRIAKSSSVEVFLS

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G10650			SBP (S-ribonuclease binding pr...		Potri.012G082200 [exp]	0	1
AT1G63120		ATRBL2	RHOMBOID-like 2 (.1)		Potri.003G122900 [exp]	2.00	0.8514
AT1G28480		roxy19, GRX480	Thioredoxin superfamily protei...		Potri.007G134800 [exp]	2.44	0.8316	PtrGrx2
AT3G54810	GATA	GATA8, BME3, BM...	GATA TRANSCRIPTION FACTOR 8, B...		Potri.010G223300 [exp]	3.46	0.8141
AT2G23810		TET8	tetraspanin8 (.1)		Potri.018G099800 [exp]	4.47	0.8100
AT3G10540			3-phosphoinositide-dependent p...		Potri.008G028800 [exp]	6.92	0.8026
AT2G20780		AtPLT4	Major facilitator superfamily ...		Potri.004G039100 [exp]	9.38	0.8513
AT5G40760		G6PD6	glucose-6-phosphate dehydrogen...		Potri.017G070200 [exp]	10.39	0.7890	Pt-ACG12.2
AT1G48850		EMB1144	embryo defective 1144, chorism...		Potri.008G040700 [exp]	15.03	0.7168
AT5G37600		ATGLN1;1, GLN1;...	ARABIDOPSIS THALIANA GLUTAMINE...		Potri.015G034700 [exp]	16.73	0.8207	Pt-NCPGS.3
AT3G17390		MAT4, SAMS3, MT...	S-ADENOSYLMETHIONINE SYNTHETAS...		Potri.008G099300 [exp]	22.60	0.8119	AdoMet1,SAMS.2

Compare expression of checked genes

Potri.012G082200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.