Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63030 155 / 5e-50 GRXC1 glutaredoxin C1, Thioredoxin superfamily protein (.1) AT5G40370 122 / 3e-37 GRXC2 glutaredoxin C2, Glutaredoxin family protein (.1.2) AT5G20500 88 / 2e-23 Glutaredoxin family protein (.1) AT2G20270 83 / 5e-21 Thioredoxin superfamily protein (.1.2) AT4G28730 79 / 1e-19 GrxC5 glutaredoxin C5, Glutaredoxin family protein (.1) AT1G77370 77 / 4e-19 Glutaredoxin family protein (.1) AT5G18600 74 / 2e-18 Thioredoxin superfamily protein (.1) AT4G15700 71 / 5e-17 Thioredoxin superfamily protein (.1) AT1G03020 71 / 5e-17 Thioredoxin superfamily protein (.1) AT4G15690 69 / 3e-16 Thioredoxin superfamily protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G078900 [exp] 167 / 1e-54 AT5G63030 171 / 3e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Potri.001G347700 [exp] 107 / 3e-31 AT5G40370 158 / 1e-51 glutaredoxin C2, Glutaredoxin family protein (.1.2) Potri.018G133400 [exp] 87 / 4e-23 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Potri.002G254100 [exp] 87 / 2e-22 AT4G28730 176 / 2e-56 glutaredoxin C5, Glutaredoxin family protein (.1) Potri.008G214600 [exp] 78 / 1e-19 AT5G18600 159 / 2e-52 Thioredoxin superfamily protein (.1) Potri.008G214800 [exp] 78 / 1e-19 AT5G18600 157 / 2e-51 Thioredoxin superfamily protein (.1) Potri.010G021800 [exp] 74 / 4e-18 AT5G18600 163 / 5e-54 Thioredoxin superfamily protein (.1) Potri.007G017300 [exp] 71 / 1e-16 AT1G77370 163 / 8e-53 Glutaredoxin family protein (.1) Potri.001G325800 [exp] 71 / 1e-16 AT3G02000 155 / 6e-50 Thioredoxin superfamily protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10042104 [exp] 146 / 1e-46 AT5G63030 177 / 1e-58 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10001237 [exp] 145 / 2e-46 AT5G63030 171 / 2e-56 glutaredoxin C1, Thioredoxin superfamily protein (.1) Lus10022253 [exp] 124 / 8e-38 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10013089 [exp] 122 / 3e-37 AT5G40370 162 / 2e-53 glutaredoxin C2, Glutaredoxin family protein (.1.2) Lus10017148 [exp] 96 / 3e-26 AT5G20500 182 / 2e-60 Glutaredoxin family protein (.1) Lus10021590 [exp] 94 / 2e-25 AT5G20500 180 / 1e-59 Glutaredoxin family protein (.1) Lus10022844 [exp] 87 / 3e-22 AT4G28730 177 / 3e-57 glutaredoxin C5, Glutaredoxin family protein (.1) Lus10033965 [exp] 71 / 8e-17 AT5G18600 148 / 5e-48 Thioredoxin superfamily protein (.1) Lus10002887 [exp] 71 / 1e-16 AT4G15690 149 / 3e-48 Thioredoxin superfamily protein (.1) Lus10005941 [exp] 70 / 1e-16 AT3G62930 145 / 8e-47 Thioredoxin superfamily protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0172 [poplar] [flax] Thioredoxin PF00462 [poplar] [flax] Glutaredoxin Glutaredoxin
Representative CDS sequence Show only first row Show all	>Potri.012G082800.1 pacid=42782951 polypeptide=Potri.012G082800.1.p locus=Potri.012G082800 ID=Potri.012G082800.1.v4.1 annot-version=v4.1 ATGGTTTCGATGCTACGTTCTTCAATCGAGATGAGCAAACAGGCTGCGCTTAAAAAGGCCAAGGAGCTTGCTTCCTCTGCTCCTGTCGTTGTTTTCAGCA AAACCTATTGTGGTTATTGCAATAGGGCGAAGCAGTTGCTGACACAGGTGGGAGCAACTTACAAGGTCATTGAACTGGATGAGCTAAGTGGTGGATACGA ACTTCAATCAGCACTAGGCCACTGGACTGGGCAAAGTACAGTACCTAATGTGTTCATTGAAGGGAAACACATTGGTGGTTGTGACTCTGTCCTGGAGAAG CACAAAAACAACCAACTCTTGCCACTTCTCAATGATGCTGGTGCTGTTGCTATCAACTCTGCCCAGCTTTGA
AA sequence Show only first row Show all	>Potri.012G082800.1 pacid=42782951 polypeptide=Potri.012G082800.1.p locus=Potri.012G082800 ID=Potri.012G082800.1.v4.1 annot-version=v4.1 MVSMLRSSIEMSKQAALKKAKELASSAPVVVFSKTYCGYCNRAKQLLTQVGATYKVIELDELSGGYELQSALGHWTGQSTVPNVFIEGKHIGGCDSVLEK HKNNQLLPLLNDAGAVAINSAQL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G63030		GRXC1	glutaredoxin C1, Thioredoxin s...		Potri.012G082800 [exp]	0	1
AT5G13170		SAG29, SWEET15,...	senescence-associated gene 29 ...		Potri.001G060900 [exp]	3.16	0.9821
AT5G23960		ATTPS21	terpene synthase 21 (.1.2)		Potri.019G020367 [exp]	3.46	0.9836
AT5G02070			Protein kinase family protein ...		Potri.013G011700 [exp]	3.74	0.9882
AT5G50400		ATPAP27, PAP27	ARABIDOPSIS THALIANA PURPLE AC...		Potri.003G202200 [exp]	5.47	0.9855
AT2G38905			Low temperature and salt respo...		Potri.008G044300 [exp]	5.91	0.9357
AT5G23660		MTN3, SWEET12, ...	homolog of Medicago truncatula...		Potri.015G101700 [exp]	6.48	0.9840
AT4G33467			unknown protein		Potri.005G058800 [exp]	8.42	0.8405
AT1G52690		LEA7	LATE EMBRYOGENESIS ABUNDANT 7,...		Potri.001G173200 [exp]	9.79	0.9583
AT3G51030		ATTRX1, ATTRXH1	ARABIDOPSIS THALIANA THIOREDOX...		Potri.005G232650 [exp]	10.58	0.9814
AT1G71450	AP2_ERF		Integrase-type DNA-binding sup...		Potri.013G101100 [exp]	11.13	0.8587

Compare expression of checked genes

Potri.012G082800 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.