Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G47740 124 / 2e-34 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) AT5G65500 57 / 2e-09 U-box domain-containing protein kinase family protein (.1) AT2G24370 57 / 3e-09 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT3G61390 54 / 2e-08 RING/U-box superfamily protein (.1.2) AT1G01680 54 / 2e-08 ATPUB54 plant U-box 54 (.1) AT4G31230 53 / 5e-08 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1) AT4G25160 49 / 2e-06 U-box domain-containing protein kinase family protein (.1) AT5G57035 48 / 3e-06 U-box domain-containing protein kinase family protein (.1) AT5G20310 46 / 8e-06 Adenine nucleotide alpha hydrolases-like superfamily protein (.1) AT5G61550 46 / 9e-06 U-box domain-containing protein kinase family protein (.1.2)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G083100 [exp] 379 / 8e-135 AT5G47740 112 / 5e-30 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.006G003900 [exp] 136 / 5e-39 AT5G47740 215 / 3e-69 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Potri.001G239100 [exp] 74 / 4e-15 AT2G45910 473 / 6e-156 U-box domain-containing protein kinase family protein (.1) Potri.009G030400 [exp] 73 / 9e-15 AT2G45910 398 / 5e-126 U-box domain-containing protein kinase family protein (.1) Potri.014G084900 [exp] 66 / 4e-12 AT2G45910 857 / 0.0 U-box domain-containing protein kinase family protein (.1) Potri.002G160200 [exp] 65 / 8e-12 AT2G45910 650 / 0.0 U-box domain-containing protein kinase family protein (.1) Potri.004G233000 [exp] 64 / 1e-11 AT4G25160 874 / 0.0 U-box domain-containing protein kinase family protein (.1) Potri.012G143100 [exp] 55 / 1e-08 AT3G49060 706 / 0.0 U-box domain-containing protein kinase family protein (.1.2) Potri.018G002400 [exp] 47 / 6e-06 AT2G24370 956 / 0.0 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10019487 [exp] 231 / 2e-76 AT5G47740 128 / 3e-36 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10043338 [exp] 228 / 5e-75 AT5G47740 128 / 2e-36 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10002238 [exp] 132 / 3e-37 AT5G47740 183 / 2e-56 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10029567 [exp] 128 / 1e-34 AT5G47740 187 / 4e-57 Adenine nucleotide alpha hydrolases-like superfamily protein (.1.2) Lus10040825 [exp] 79 / 1e-16 AT2G45910 496 / 1e-163 U-box domain-containing protein kinase family protein (.1) Lus10016557 [exp] 75 / 3e-15 AT2G45910 508 / 3e-168 U-box domain-containing protein kinase family protein (.1) Lus10014772 [exp] 72 / 4e-14 AT3G49060 901 / 0.0 U-box domain-containing protein kinase family protein (.1.2) Lus10036362 [exp] 68 / 6e-13 AT3G49060 895 / 0.0 U-box domain-containing protein kinase family protein (.1.2) Lus10036359 [exp] 56 / 9e-09 AT2G45910 598 / 0.0 U-box domain-containing protein kinase family protein (.1) Lus10027592 [exp] 47 / 3e-06 AT3G20200 175 / 2e-50 Protein kinase protein with adenine nucleotide alpha hydrolases-like domain (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G084700.1 pacid=42783311 polypeptide=Potri.012G084700.1.p locus=Potri.012G084700 ID=Potri.012G084700.1.v4.1 annot-version=v4.1 ATGGAAGAGGAGAAATATGTGCCGGCAAGTTCTATGCGGTACGGTGCGCGAATCATGTCGCCCGAAATTGTGGAGATAGGAGAAGACATCAAGCCTATTT CTAACAGCATAGATGGAGTCAGTCATGATGTTTATGTAGCTGTTGGTAAAAATGACACAGATGTACTGAAGTGGGCTCTAGATCATGCTGTTTTACCTGG AGCTCGAGTTTTTCTAGTCCATGTTTTTCCTCCTCTGACATATATTCCTACACCAGTTGGAAGACTATCTAGGAGCCAATTGAGCCAAGATCAGATGAGA TTTTACATTAATGAAGAGAATAACAGAAGAAGAAACCATTTGCAAAAATACATTAGCCTGTGTGCCGATGCCAAGGTGACAGTGGATACAATGCTCCTGG AGAGCAATTCCACTGCCAAAGCTATTCTAGAGCTCATTCCCGTTCTCAACATTAGACACCTTGTCATGGGAACTAAACGCTTGCCTCGCTCAAGGCTACT AAGGAAGAAGCTGGCGAAAGGAGAATTTGTGAAGAAGAATGCTCCAGACTATTGTGAGGTTAGTATTATTCATGAAAGCAAGAAGATCATGGATGGTCAG CATGGGATAGAGCCAGTTTCATCCTGTCCCCAAAGACCTGATGTCATCCGCAACTCTGAAAAGAAGTTTTTCGAGCTTGCATGCTTTTCAGGCAAGTTGA AGTGA
AA sequence Show only first row Show all	>Potri.012G084700.1 pacid=42783311 polypeptide=Potri.012G084700.1.p locus=Potri.012G084700 ID=Potri.012G084700.1.v4.1 annot-version=v4.1 MEEEKYVPASSMRYGARIMSPEIVEIGEDIKPISNSIDGVSHDVYVAVGKNDTDVLKWALDHAVLPGARVFLVHVFPPLTYIPTPVGRLSRSQLSQDQMR FYINEENNRRRNHLQKYISLCADAKVTVDTMLLESNSTAKAILELIPVLNIRHLVMGTKRLPRSRLLRKKLAKGEFVKKNAPDYCEVSIIHESKKIMDGQ HGIEPVSSCPQRPDVIRNSEKKFFELACFSGKLK

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G47740			Adenine nucleotide alpha hydro...		Potri.012G084700 [exp]	0	1
AT1G67050			unknown protein		Potri.017G115700 [exp]	1.00	0.8898
AT1G26320			Zinc-binding dehydrogenase fam...		Potri.017G002300 [exp]	3.87	0.8730
AT5G64330		JK218, RPT3, NP...	ROOT PHOTOTROPISM 3, NON-PHOTO...		Potri.017G048200 [exp]	4.89	0.8824
AT1G55020		ATLOX1, LOX1	ARABIDOPSIS LIPOXYGENASE 1, li...		Potri.013G022000 [exp]	5.65	0.8604	Pt-LOX1.6
AT1G73360	HD	ATHDG11, HDG11,...	ENHANCED DROUGHT TOLERANCE 1, ...		Potri.015G034100 [exp]	6.32	0.8759
AT4G00730	HD	AHDP, ANL2	ANTHOCYANINLESS 2, ARABIDOPSIS...		Potri.002G154700 [exp]	10.77	0.8850	Pt-ANL2.1
AT5G43940		PAR2, ATGSNOR1,...	PARAQUAT RESISTANT 2, sensitiv...		Potri.002G254900 [exp]	11.22	0.8487	FDH1
AT4G39400		DWF2, CBB2, BIN...	DWARF 2, CABBAGE 2, BRASSINOST...		Potri.005G086500 [exp]	11.48	0.8708	Pt-BRI1.1
AT1G05230	HD	HDG2	homeodomain GLABROUS 2 (.1.2.3...		Potri.002G230200 [exp]	12.40	0.8633
AT2G24220		ATPUP5	purine permease 5 (.1.2)		Potri.006G184900 [exp]	16.94	0.8242

Compare expression of checked genes

Potri.012G084700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.