Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT5G63130 138 / 9e-42 Octicosapeptide/Phox/Bem1p family protein (.1) AT3G48240 136 / 5e-41 Octicosapeptide/Phox/Bem1p family protein (.1) AT1G70640 107 / 1e-29 octicosapeptide/Phox/Bem1p (PB1) domain-containing protein (.1) AT3G26510 105 / 6e-29 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) AT5G49920 95 / 6e-24 Octicosapeptide/Phox/Bem1p family protein (.1) AT3G46920 96 / 3e-23 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) AT5G57610 92 / 4e-22 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) AT4G05150 86 / 1e-19 Octicosapeptide/Phox/Bem1p family protein (.1) AT2G35050 86 / 1e-19 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) AT1G04700 85 / 2e-19 PB1 domain-containing protein tyrosine kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G083400 [exp] 248 / 2e-85 AT3G48240 152 / 2e-47 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.008G186500 [exp] 126 / 7e-37 AT3G26510 152 / 1e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Potri.010G046400 [exp] 117 / 3e-33 AT3G26510 152 / 5e-46 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Potri.006G190200 [exp] 93 / 3e-22 AT3G46920 652 / 0.0 Protein kinase superfamily protein with octicosapeptide/Phox/Bem1p domain (.1) Potri.004G032200 [exp] 91 / 9e-22 AT4G05150 333 / 1e-110 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.003G006200 [exp] 89 / 1e-21 AT5G49920 188 / 3e-58 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.001G285800 [exp] 90 / 2e-21 AT5G64430 270 / 8e-85 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.011G041100 [exp] 89 / 4e-21 AT4G05150 297 / 4e-96 Octicosapeptide/Phox/Bem1p family protein (.1) Potri.001G052000 [exp] 90 / 5e-21 AT1G04700 721 / 0.0 PB1 domain-containing protein tyrosine kinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10043341 [exp] 157 / 4e-49 AT3G48240 145 / 2e-44 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10019490 [exp] 149 / 2e-45 AT3G48240 149 / 9e-46 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10002938 [exp] 122 / 2e-35 AT3G48240 130 / 1e-38 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10017947 [exp] 119 / 1e-34 AT5G63130 121 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10026700 [exp] 113 / 7e-32 AT3G26510 135 / 3e-40 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Lus10006214 [exp] 97 / 9e-26 AT3G26510 123 / 1e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Lus10036862 [exp] 97 / 2e-25 AT3G26510 122 / 3e-35 Octicosapeptide/Phox/Bem1p family protein (.1.2.3.4.5) Lus10002588 [exp] 98 / 4e-24 AT4G05150 319 / 2e-104 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10018412 [exp] 94 / 7e-23 AT4G05150 304 / 1e-98 Octicosapeptide/Phox/Bem1p family protein (.1) Lus10035641 [exp] 91 / 7e-23 AT5G09620 243 / 6e-78 Octicosapeptide/Phox/Bem1p family protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description CL0072 [poplar] [flax] Ubiquitin PF00564 [poplar] [flax] PB1 PB1 domain
Representative CDS sequence Show only first row Show all	>Potri.012G085000.2 pacid=42782840 polypeptide=Potri.012G085000.2.p locus=Potri.012G085000 ID=Potri.012G085000.2.v4.1 annot-version=v4.1 ATGAGTATTGACTGTAAAACAAAAACGAAACCAGAAACTCTCAAGTTTCTATGTAGTTACGGTGGTAAAATTCTTCCTCGTTCCAGCGACGGCGTTCTCC GTTACGTTGGTGGTTTAACCAGAGTTCTGGCCGTCGACCGTTCAATATCCTATGCAGAGTTGATGGTGAAGCTAGGTGAATTCTGTGGATATTCGGTGGA ATTAAGGTGTCAGTTACCAGACGGAGATTTGGAGACGTTAATTTCTGTAAAATCGGAGGATGAATTAAAGAGCTTGATTCTCGAATTCGATAGATCTTGT CCTGGTTCGAAGATTAGAGCTATTTTGTCTCCTCCGAAATCGCTCAAGAAAATCTCTCCCCCGACATCCAATGCTTCCAGTATCGACTTTTCACCTACCA AATCGTTTCTCAATTATCACCAATCTCGCAGTTGCTCCCCTCCGATTGGATATAAAGGCCGCTACTCTCCAAGCCGCAGACAAGAATCGCTGTGTTATAA CCATCAGTGTTGTGATTATTGGCACTAA
AA sequence Show only first row Show all	>Potri.012G085000.2 pacid=42782840 polypeptide=Potri.012G085000.2.p locus=Potri.012G085000 ID=Potri.012G085000.2.v4.1 annot-version=v4.1 MSIDCKTKTKPETLKFLCSYGGKILPRSSDGVLRYVGGLTRVLAVDRSISYAELMVKLGEFCGYSVELRCQLPDGDLETLISVKSEDELKSLILEFDRSC PGSKIRAILSPPKSLKKISPPTSNASSIDFSPTKSFLNYHQSRSCSPPIGYKGRYSPSRRQESLCYNHQCCDYWH

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT5G63130			Octicosapeptide/Phox/Bem1p fam...		Potri.012G085000 [exp]	0	1
AT1G18300		ATNUDT4	nudix hydrolase homolog 4 (.1)		Potri.015G035000 [exp]	1.73	0.7909
AT2G30020			Protein phosphatase 2C family ...		Potri.009G073000 [exp]	10.86	0.7978	Pt-MP2.9
AT4G24380			unknown protein		Potri.002G102500 [exp]	11.31	0.7575
AT3G15040			Protein of unknown function, D...		Potri.006G209500 [exp]	11.31	0.7791
AT3G01400			ARM repeat superfamily protein...		Potri.002G118800 [exp]	18.43	0.7652
AT1G59600		ZCW7	ZCW7 (.1)		Potri.002G118300 [exp]	18.76	0.7220
AT2G30020			Protein phosphatase 2C family ...		Potri.001G278500 [exp]	22.36	0.7520
AT4G04960			Concanavalin A-like lectin pro...		Potri.004G044200 [exp]	24.73	0.7399
AT5G62865			unknown protein		Potri.018G114200 [exp]	25.39	0.7267
AT4G02040			unknown protein		Potri.008G198000 [exp]	27.23	0.7614

Compare expression of checked genes

Potri.012G085000 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.