Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT1G14870 165 / 2e-52 AtPCR2, PCR2 PLANT CADMIUM RESISTANCE 2 (.1) AT5G35525 160 / 1e-50 PLAC8 family protein (.1) AT1G14880 145 / 6e-45 AtPCR1, PCR1 PLANT CADMIUM RESISTANCE 1 (.1) AT3G18470 127 / 6e-38 PLAC8 family protein (.1) AT1G68610 127 / 1e-37 PCR11 PLANT CADMIUM RESISTANCE 11 (.1) AT1G49030 129 / 2e-37 PLAC8 family protein (.1) AT3G18460 125 / 1e-36 PLAC8 family protein (.1) AT1G68630 118 / 5e-34 PLAC8 family protein (.1) AT3G18450 116 / 6e-33 PLAC8 family protein (.1) AT1G52200 109 / 2e-30 PLAC8 family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.007G042800 [exp] 213 / 2e-71 AT1G14870 152 / 7e-48 PLANT CADMIUM RESISTANCE 2 (.1) Potri.008G132850 [exp] 171 / 2e-54 AT1G14870 184 / 6e-60 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G109100 [exp] 171 / 3e-54 AT1G14870 165 / 1e-52 PLANT CADMIUM RESISTANCE 2 (.1) Potri.008G132775 [exp] 167 / 9e-53 AT1G14870 185 / 2e-60 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G127700 [exp] 162 / 8e-51 AT1G68610 174 / 5e-56 PLANT CADMIUM RESISTANCE 11 (.1) Potri.010G108900 [exp] 159 / 2e-49 AT1G14870 142 / 4e-43 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G108800 [exp] 155 / 3e-48 AT1G14870 179 / 8e-58 PLANT CADMIUM RESISTANCE 2 (.1) Potri.008G132900 [exp] 153 / 3e-47 AT1G14870 189 / 7e-62 PLANT CADMIUM RESISTANCE 2 (.1) Potri.010G127800 [exp] 147 / 2e-45 AT1G68630 151 / 1e-47 PLAC8 family protein (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10021696 [exp] 164 / 2e-51 AT1G14870 177 / 5e-57 PLANT CADMIUM RESISTANCE 2 (.1) Lus10034298 [exp] 154 / 1e-47 AT1G14870 160 / 7e-51 PLANT CADMIUM RESISTANCE 2 (.1) Lus10043325 [exp] 149 / 1e-45 AT1G14870 187 / 4e-61 PLANT CADMIUM RESISTANCE 2 (.1) Lus10019478 [exp] 142 / 3e-43 AT1G14870 184 / 7e-60 PLANT CADMIUM RESISTANCE 2 (.1) Lus10004063 [exp] 133 / 3e-40 AT1G68630 132 / 2e-40 PLAC8 family protein (.1) Lus10009036 [exp] 129 / 1e-38 AT1G68630 122 / 2e-36 PLAC8 family protein (.1) Lus10008890 [exp] 120 / 4e-35 AT1G68630 119 / 6e-35 PLAC8 family protein (.1) Lus10041474 [exp] 109 / 1e-30 AT1G14870 112 / 3e-32 PLANT CADMIUM RESISTANCE 2 (.1) Lus10004064 [exp] 112 / 9e-29 AT4G30040 156 / 3e-41 Eukaryotic aspartyl protease family protein (.1) Lus10005257 [exp] 93 / 8e-24 AT2G40935 228 / 6e-77 PLAC8 family protein (.1.2.3)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF04749 [poplar] [flax] PLAC8 PLAC8 family
Representative CDS sequence Show only first row Show all	>Potri.012G092200.2 pacid=42784393 polypeptide=Potri.012G092200.2.p locus=Potri.012G092200 ID=Potri.012G092200.2.v4.1 annot-version=v4.1 ATGTATCCTCCAGTAAATGACCAGCCAAGATATCCAGTAGATGTTCATCAAGGCCCAATGCTTGTTTCAGGAGCTCCTACTCCCAATCCTATGTACACTT ATGCTCTGCATATGGCCGTGGGGCATGCTCCTGGTGTGGCAAGGAAGTGGTCTACTGGTCTCTGCCATTGCTGTGATGATCCTGCAAATTGTTTGATCAC TTGCTTTTGTCCTTGCATCACATTTGGACAGATTGCTGAAATTGTGAATAGGGGATCTACAACTTGTTTTATTAGTGGAGCAGTATATGCGCTATTGCTG GGTTTTGCATGCTTGTACTCCTGTTGCTATCGCTCAAAATTGAGGGGCCAATATGACTTGGAGGAGGCCCCTTGTGTGGATTGCCTAGTGCACTTCTGCT GTGAGACTTGCGCGTTGAGTCAAGAGTATAGAGAGCTCAAGAATCGTGGATTTGATATGGGGATAGGCTGGGAAGCCAATATGGCTAGATTTCAACAGCG TGGAATCACAATGGCTCCAATTGCGCCCCCAGGCATGACAAGATGA
AA sequence Show only first row Show all	>Potri.012G092200.2 pacid=42784393 polypeptide=Potri.012G092200.2.p locus=Potri.012G092200 ID=Potri.012G092200.2.v4.1 annot-version=v4.1 MYPPVNDQPRYPVDVHQGPMLVSGAPTPNPMYTYALHMAVGHAPGVARKWSTGLCHCCDDPANCLITCFCPCITFGQIAEIVNRGSTTCFISGAVYALLL GFACLYSCCYRSKLRGQYDLEEAPCVDCLVHFCCETCALSQEYRELKNRGFDMGIGWEANMARFQQRGITMAPIAPPGMTR

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT1G14870		AtPCR2, PCR2	PLANT CADMIUM RESISTANCE 2 (.1...		Potri.012G092200 [exp]	0	1
AT3G55470			Calcium-dependent lipid-bindin...		Potri.010G203100 [exp]	1.41	0.9748
AT5G54370			Late embryogenesis abundant (L...		Potri.012G145400 [exp]	3.46	0.9494
AT4G37160		SKS15	SKU5 similar 15 (.1)		Potri.007G038200 [exp]	4.58	0.9508
AT1G50720			Stigma-specific Stig1 family p...		Potri.001G356600 [exp]	4.89	0.9445
AT5G60520			Late embryogenesis abundant (L...		Potri.009G012600 [exp]	4.89	0.9555
AT5G44640		BGLU13	beta glucosidase 13 (.1)		Potri.003G211100 [exp]	5.91	0.9448
AT1G63410			Protein of unknown function (D...		Potri.001G106300 [exp]	10.19	0.9256
AT1G06330			Heavy metal transport/detoxifi...		Potri.019G107500 [exp]	10.95	0.9282
AT5G44640		BGLU13	beta glucosidase 13 (.1)		Potri.001G015100 [exp]	11.66	0.9315	Pt-L1.1
AT5G06905		CYP712A2	"cytochrome P450, family 712, ...		Potri.016G050200 [exp]	14.00	0.9321	CYP712.2

Compare expression of checked genes

Potri.012G092200 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.