Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT2G04410 80 / 6e-21 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G55850 79 / 5e-20 NOI RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) AT5G63270 77 / 6e-20 RPM1-interacting protein 4 (RIN4) family protein (.1) AT5G40645 72 / 6e-18 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G48450 71 / 2e-17 RPM1-interacting protein 4 (RIN4) family protein (.1) AT4G35655 70 / 4e-17 RPM1-interacting protein 4 (RIN4) family protein (.1) AT2G17660 68 / 3e-16 RPM1-interacting protein 4 (RIN4) family protein (.1) AT3G25070 51 / 1e-08 RIN4 RPM1 interacting protein 4 (.1) AT5G19473 38 / 0.0002 RPM1-interacting protein 4 (RIN4) family protein (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G089201 [exp] 129 / 1e-40 AT2G04410 90 / 1e-25 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.011G094200 [exp] 82 / 4e-21 AT5G55850 123 / 8e-38 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.001G368900 [exp] 76 / 2e-19 AT5G55850 124 / 4e-39 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Potri.001G338500 [exp] 76 / 3e-19 AT5G40645 82 / 1e-22 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.014G168900 [exp] 71 / 2e-17 AT2G04410 102 / 1e-30 RPM1-interacting protein 4 (RIN4) family protein (.1) Potri.002G245400 [exp] 52 / 6e-09 AT3G25070 169 / 3e-52 RPM1 interacting protein 4 (.1) Potri.011G022000 [exp] 50 / 3e-08 AT3G25070 74 / 6e-16 RPM1 interacting protein 4 (.1) Potri.004G002500 [exp] 47 / 2e-07 AT3G25070 75 / 1e-16 RPM1 interacting protein 4 (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032112 [exp] 79 / 5e-20 AT5G55850 80 / 1e-20 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10022524 [exp] 77 / 1e-19 AT2G04410 104 / 2e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10016623 [exp] 74 / 1e-18 AT2G04410 105 / 1e-31 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10014574 [exp] 72 / 5e-18 AT5G55850 76 / 1e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10012316 [exp] 68 / 4e-16 AT5G55850 87 / 4e-24 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10006361 [exp] 67 / 5e-16 AT5G55850 73 / 7e-19 RPM1-interacting protein 4 (RIN4) family protein (.1), RPM1-interacting protein 4 (RIN4) family protein (.2), RPM1-interacting protein 4 (RIN4) family protein (.3) Lus10025949 [exp] 66 / 1e-15 AT2G17660 87 / 2e-24 RPM1-interacting protein 4 (RIN4) family protein (.1) Lus10040889 [exp] 59 / 2e-11 AT1G53000 147 / 6e-44 CMP-KDO synthetase, Nucleotide-diphospho-sugar transferases superfamily protein (.1) Lus10022776 [exp] 51 / 1e-08 AT3G25070 155 / 4e-47 RPM1 interacting protein 4 (.1) Lus10011841 [exp] 51 / 2e-08 AT3G07170 196 / 9e-61 Sterile alpha motif (SAM) domain-containing protein (.1)
PFAM info	Clan ID Clan name Pfam ID Pfam name Pfam description PF05627 [poplar] [flax] AvrRpt-cleavage Cleavage site for pathogenic type III effector avirulence factor Avr
Representative CDS sequence Show only first row Show all	>Potri.012G092601.1 pacid=42782508 polypeptide=Potri.012G092601.1.p locus=Potri.012G092601 ID=Potri.012G092601.1.v4.1 annot-version=v4.1 ATGATTTTTCTCTTTCAGCAAGGTCGGCCTTTGCCCAAGTTTGGTGAGTGGGATGTGAACAACCCTGCCTCTGCTGAAGGATTCACAGTCATATTCAACA AGGCTAGAGACGAGAAGAAGACCAAAAATAGTCCTGCAAAAGTTGTTTCGCCACGGAGAACTGAACCTGTGTTCAACAAAAATGCCAAAAATGAGAACTA TGAGCATCCTCCGAAGGTGCATGTTTTAAATGAGCCATTTTCAAGTCCTCTTTCCCTTTCATTGGTTTTTGTATTTGCGAATTCAAGGTTTCTTATAGCT CAATTATCTTCTCATGCAGAGGAGGTGGCTTTGCTATGTTGA
AA sequence Show only first row Show all	>Potri.012G092601.1 pacid=42782508 polypeptide=Potri.012G092601.1.p locus=Potri.012G092601 ID=Potri.012G092601.1.v4.1 annot-version=v4.1 MIFLFQQGRPLPKFGEWDVNNPASAEGFTVIFNKARDEKKTKNSPAKVVSPRRTEPVFNKNAKNENYEHPPKVHVLNEPFSSPLSLSLVFVFANSRFLIA QLSSHAEEVALLC

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT2G04410			RPM1-interacting protein 4 (RI...		Potri.012G092601 [exp]	0	1
AT3G28880			Ankyrin repeat family protein ...		Potri.004G129100 [exp]	2.82	0.8893
AT5G54240			Protein of unknown function (D...		Potri.001G408001 [exp]	6.85	0.9083
AT5G05800			unknown protein		Potri.008G196901 [exp]	11.83	0.9035
AT3G57880			Calcium-dependent lipid-bindin...		Potri.011G052000 [exp]	12.84	0.8623
AT3G48860			unknown protein		Potri.001G065800 [exp]	15.87	0.8964
AT2G44610		RAB6, AtRABH1b,...	Ras-related small GTP-binding ...		Potri.001G147900 [exp]	19.05	0.9026
AT5G17770		CBR1, ATCBR	NADH:cytochrome B5 reductase 1...		Potri.007G072750 [exp]	23.06	0.8962
AT4G18760		AtRLP51	receptor like protein 51 (.1)		Potri.011G069500 [exp]	23.55	0.8974
AT2G38020		EMB258, MAN, VC...	VACUOLELESS 1, MANGLED, vacuol...		Potri.002G057800 [exp]	28.00	0.8841	Pt-VCL1.3
AT4G27080		ATPDI7, ATPDIL5...	ARABIDOPSIS THALIANA PROTEIN D...		Potri.011G135500 [exp]	29.32	0.8989

Compare expression of checked genes

Potri.012G092601 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.