Potri.012G095166 [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT5G63390 288 / 3e-95 O-fucosyltransferase family protein (.1)
AT2G44500 217 / 2e-69 O-fucosyltransferase family protein (.1.2)
AT3G07900 192 / 3e-58 O-fucosyltransferase family protein (.1)
AT1G20550 105 / 3e-26 O-fucosyltransferase family protein (.1)
AT1G76270 105 / 3e-26 O-fucosyltransferase family protein (.1)
AT4G38390 99 / 7e-24 RHS17 root hair specific 17 (.1)
AT5G65470 98 / 1e-23 O-fucosyltransferase family protein (.1)
AT5G35570 95 / 1e-22 O-fucosyltransferase family protein (.1)
AT5G01100 94 / 2e-22 O-fucosyltransferase family protein (.1)
AT1G04910 94 / 3e-22 O-fucosyltransferase family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G092600 342 / 2e-116 AT5G63390 697 / 0.0 O-fucosyltransferase family protein (.1)
Potri.001G227000 235 / 1e-74 AT2G44500 754 / 0.0 O-fucosyltransferase family protein (.1.2)
Potri.009G022500 234 / 2e-74 AT2G44500 744 / 0.0 O-fucosyltransferase family protein (.1.2)
Potri.002G011100 103 / 8e-26 AT1G76270 759 / 0.0 O-fucosyltransferase family protein (.1)
Potri.005G249900 103 / 1e-25 AT1G76270 776 / 0.0 O-fucosyltransferase family protein (.1)
Potri.001G157400 102 / 2e-25 AT4G16650 773 / 0.0 O-fucosyltransferase family protein (.1)
Potri.007G011000 101 / 5e-25 AT5G65470 784 / 0.0 O-fucosyltransferase family protein (.1)
Potri.004G183200 100 / 1e-24 AT1G76270 713 / 0.0 O-fucosyltransferase family protein (.1)
Potri.003G077500 100 / 2e-24 AT4G16650 785 / 0.0 O-fucosyltransferase family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10003914 228 / 5e-72 AT2G44500 765 / 0.0 O-fucosyltransferase family protein (.1.2)
Lus10037475 183 / 7e-56 AT2G44500 672 / 0.0 O-fucosyltransferase family protein (.1.2)
Lus10014444 112 / 1e-28 AT1G20550 650 / 0.0 O-fucosyltransferase family protein (.1)
Lus10023948 109 / 1e-27 AT1G20550 697 / 0.0 O-fucosyltransferase family protein (.1)
Lus10012270 109 / 1e-27 AT1G76270 758 / 0.0 O-fucosyltransferase family protein (.1)
Lus10013234 102 / 3e-25 AT1G76270 791 / 0.0 O-fucosyltransferase family protein (.1)
Lus10007481 102 / 4e-25 AT4G16650 766 / 0.0 O-fucosyltransferase family protein (.1)
Lus10028957 102 / 5e-25 AT4G16650 771 / 0.0 O-fucosyltransferase family protein (.1)
Lus10004729 101 / 7e-25 AT4G16650 756 / 0.0 O-fucosyltransferase family protein (.1)
Lus10030754 100 / 2e-24 AT1G76270 787 / 0.0 O-fucosyltransferase family protein (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
CL0113 GT-B PF10250 O-FucT GDP-fucose protein O-fucosyltransferase
Representative CDS sequence
>Potri.012G095166.1 pacid=42783452 polypeptide=Potri.012G095166.1.p locus=Potri.012G095166 ID=Potri.012G095166.1.v4.1 annot-version=v4.1
ATGGCAAAGAGTTTAATGGCGCCATTACCACTGCTGCCAGTTACTGGCAATGTGTCAAAAGAGGAGAGAGGTTTCTGGGGGCAACCAGATGGAGAAGGGT
ACAAGCCATACTTGCATTTTAGTCTCAAGTATCGAAAGGCATCTGCGAGAATTGCGAAGGAGAGGAGGTTGTTCTTGGTGGTGGTAGCCTCAGGGGGACT
GAACCATCGGAGGAATCAGATTGTTTATGCTGTTGTTATTGCAAGAAATCTTGAAGCAGCTTTGGTTGCGCCCGTTTTGAAGGTTAATCCAATTTGGGGT
GATGAGAGTGAATTCTCGGAGATTTTCAATGCTGAGCATTTCAAGAGAGTTTTACGAGCTGATGTACAAATTGTATCATCCCTTCCCTCCGAACATTTGA
TGTCAAAGCAGTCCATAGAAAACCAAATTCCTTATGATGTCTCACCAAATTGGATCCGTGCCAGGTGGTTTATGTATCTGAATGAAGAAAGTCTGCTTAT
CCTAAAAGAATTAGACTCCAAACTTTCCAAGAATCTTCCACTCGATCTGCAGAAGCTGCGATGCAAGGTTGCATTCCATGCGCTGAGATTTGCGGCACCC
ATATAG
AA sequence
>Potri.012G095166.1 pacid=42783452 polypeptide=Potri.012G095166.1.p locus=Potri.012G095166 ID=Potri.012G095166.1.v4.1 annot-version=v4.1
MAKSLMAPLPLLPVTGNVSKEERGFWGQPDGEGYKPYLHFSLKYRKASARIAKERRLFLVVVASGGLNHRRNQIVYAVVIARNLEAALVAPVLKVNPIWG
DESEFSEIFNAEHFKRVLRADVQIVSSLPSEHLMSKQSIENQIPYDVSPNWIRARWFMYLNEESLLILKELDSKLSKNLPLDLQKLRCKVAFHALRFAAP
I

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT5G63390 O-fucosyltransferase family pr... Potri.012G095166 0 1
AT1G65930 cICDH cytosolic NADP+-dependent isoc... Potri.010G176000 3.16 0.7501 IDH1.2
AT1G05630 AT5PTASE13, 5PT... Endonuclease/exonuclease/phosp... Potri.017G006900 7.54 0.7275
Potri.006G072950 15.32 0.7618
AT4G20790 Leucine-rich repeat protein ki... Potri.011G157600 24.00 0.7228
AT5G49610 F-box family protein (.1) Potri.015G028500 24.24 0.6768
AT3G11690 unknown protein Potri.016G066300 34.89 0.6444
AT2G27285 Coiled-coil domain-containing ... Potri.004G201300 52.96 0.6729
AT4G21760 BGLU47 beta-glucosidase 47 (.1) Potri.004G019800 84.07 0.6353
Potri.003G056450 91.19 0.6222
AT5G66815 unknown protein Potri.014G034500 98.10 0.6313

Potri.012G095166 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.