Plant FIBer expression Database

External link	JGI Phytozome v13 [genome browser] Popgenie AspWood
Symbol
Arabidopsis homologues Show only best Show top 10	Locus ID BLAST score/e-value TF class Alias TAIR10 short description AT3G01820 90 / 5e-23 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G39270 49 / 7e-08 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) AT2G37250 46 / 9e-07 ADK, ATPADK1 adenosine kinase (.1)
Paralogs Show only best Show top 10	Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Potri.015G093200 [exp] 159 / 9e-50 AT3G01820 227 / 3e-74 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.001G333100 [exp] 87 / 6e-22 AT3G01820 249 / 8e-83 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Potri.010G215300 [exp] 53 / 3e-09 AT2G37250 382 / 2e-134 adenosine kinase (.1) Potri.008G046100 [exp] 50 / 4e-08 AT2G37250 377 / 1e-132 adenosine kinase (.1)
Flax homologues Show only best Show top 10	Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description Lus10032057 [exp] 108 / 7e-30 AT3G01820 244 / 5e-81 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10035224 [exp] 107 / 2e-29 AT3G01820 242 / 3e-80 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10022342 [exp] 99 / 3e-26 AT3G01820 255 / 4e-85 P-loop containing nucleoside triphosphate hydrolases superfamily protein (.1) Lus10040358 [exp] 52 / 1e-08 AT2G37250 405 / 1e-143 adenosine kinase (.1) Lus10023476 [exp] 51 / 2e-08 AT2G37250 407 / 2e-144 adenosine kinase (.1) Lus10001984 [exp] 49 / 8e-08 AT2G37250 391 / 4e-138 adenosine kinase (.1) Lus10030296 [exp] 49 / 9e-08 AT2G37250 395 / 1e-139 adenosine kinase (.1)
PFAM info
Representative CDS sequence Show only first row Show all	>Potri.012G095700.1 pacid=42782978 polypeptide=Potri.012G095700.1.p locus=Potri.012G095700 ID=Potri.012G095700.1.v4.1 annot-version=v4.1 ATGGCTGACACAGCGTATTTCAATGGTGAAACTGTTCTGGATGGAATTCCTCGCAAGCAGTTCCAAGTTGAGATTCTTGATCAACTTGTGGAGATTGATT TGGCTGTGGGTTTTAGATGCACTGATGATTACTTGGTGAAACAACAACAAGCAGGTGCCTGGAAACAGAAGCTCCAAGCTTATGCTGAACAGAGCAGGCC ACTAGAAGATTGTTACCAGAAACGGAAAAGGCTTCTTGACTTTCAAGTAGGCAGTGCACCTGCAGAGAATTGGCAAGGGCTGTTAGCTGCACTACATCTA CAACACACAAATACTGTATATTCTTCAAAGAAACTGGCTGTAAGATCTAGCTTGCTCTAA
AA sequence Show only first row Show all	>Potri.012G095700.1 pacid=42782978 polypeptide=Potri.012G095700.1.p locus=Potri.012G095700 ID=Potri.012G095700.1.v4.1 annot-version=v4.1 MADTAYFNGETVLDGIPRKQFQVEILDQLVEIDLAVGFRCTDDYLVKQQQAGAWKQKLQAYAEQSRPLEDCYQKRKRLLDFQVGSAPAENWQGLLAALHL QHTNTVYSSKKLAVRSSLL

---

DESeq2's median of ratios [POPLAR]

Mapped by: StringTie Salmon Order by: Tissue Experiment Show only core collection Show again Show schematic diagram

---

Coexpressed genes

Compare expression of checked genes Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.

At best	At TF class	At alias	At description		Locus	MR	r	Symbol	NWA:WT	NWB:WT	NWA:OE-ARK2	NWB:OE-ARK2	NWA:miRNA-ARK2	NWB:miRNA-ARK2	NW 0hr	WT H20	WT-NW	TUA1dEY NW	TUA1dEY+TUB15 NW	TUA1dY+TUB9 NW	Pde NW	NWA:WT GA	NWBWT GA	TW:WT	TW:WT GA	NWA:OE-ARK2 GA	NWB:OE-ARK2 GA	TW:OE-ARK2	TW:OE-ARK2 GA	NWA:miRNA-ARK2 GA	NWB:miRNA-ARK2 GA	TW:miRNA-ARK2	TW:miRNA-ARK2 GA	TW 2hr	TW 8hr	TW 24hr	TW 48hr	TW 96hr	TW 336hr	WT ACC	35S::etr1-1 H20	35S::etr1-1 ACC	LMX5::etr1-1 H20	LMX5::etr1-1 ACC	WT-TW	TUA1dEY TW	TUA1dEY+TUB15 TW	TUA1dY+TUB9 TW	Pde TW	OW:WT	OW:WT GA	OW:OE-ARK2	OW:OE-ARK2 GA	OW:miRNA-ARK2	OW:miRNA-ARK2 GA	OW 2hr	OW 8hr	OW 24hr	OW 48hr	OW 96hr	OW 336hr	Root CTR	Root LongCold	Root LongDrougt	Root LongHeat	Root LongSalt	Root ShortCold	Root ShortDrougt	Root ShortHeat	Root ShortSalt	Ptr root	Leaf CTR	Leaf LongCold	Leaf LongDrougt	Leaf LongHeat	Leaf LongSalt	Leaf ShortCold	Leaf ShortDrougt	Leaf ShortHeat	Leaf ShortSalt	Ptr leaf	Stem CTR	Stem LongCold	Stem LongDrougt	Stem LongHeat	Stem LongSalt	Stem ShortCold	Stem ShortDrougt	Stem ShortHeat	Stem ShortSalt	Ptr shoot	Ptr xylem	Ptr phloem	Ptr fiber	Ptr vessel	Ptr fiber vessel ray
AT3G01820			P-loop containing nucleoside t...		Potri.012G095700 [exp]	0	1
AT4G35420		TKPR1, DRL1	tetraketide alpha-pyrone reduc...		Potri.008G138600 [exp]	3.46	0.8813
					Potri.002G259500 [exp]	6.70	0.8855
AT5G39130			RmlC-like cupins superfamily p...		Potri.004G180100 [exp]	9.38	0.7932
					Potri.004G074602 [exp]	9.74	0.7999
AT1G69940		ATPPME1	Pectin lyase-like superfamily ...		Potri.006G186100 [exp]	11.48	0.8641
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G184100 [exp]	15.42	0.8526
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G182800 [exp]	17.43	0.8510
					Potri.008G130950 [exp]	17.60	0.8394
AT2G16230			O-Glycosyl hydrolases family 1...		Potri.014G183800 [exp]	19.79	0.8171
AT5G55980			serine-rich protein-related (....		Potri.001G371400 [exp]	20.85	0.8152

Compare expression of checked genes

Potri.012G095700 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.