Pt-EEF1.2 (Potri.012G096400) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-EEF1.2
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT2G18110 275 / 4e-94 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
AT1G30230 268 / 2e-91 Glutathione S-transferase, C-terminal-like;Translation elongation factor EF1B/ribosomal protein S6 (.1.2)
AT5G12110 186 / 3e-59 Glutathione S-transferase, C-terminal-like;Translation elongation factor EF1B/ribosomal protein S6 (.1)
AT5G19510 157 / 6e-48 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G094200 306 / 2e-106 AT2G18110 299 / 1e-103 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Potri.009G018600 162 / 6e-50 AT2G18110 158 / 3e-48 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Potri.001G224700 158 / 3e-48 AT2G18110 153 / 3e-46 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10037618 256 / 1e-86 AT2G18110 319 / 2e-111 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Lus10013555 254 / 1e-85 AT2G18110 313 / 3e-109 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Lus10017261 249 / 6e-82 AT2G18110 308 / 3e-105 Translation elongation factor EF1B/ribosomal protein S6 family protein (.1)
Lus10036101 158 / 4e-48 AT5G12110 296 / 1e-102 Glutathione S-transferase, C-terminal-like;Translation elongation factor EF1B/ribosomal protein S6 (.1)
Lus10026784 158 / 5e-48 AT5G12110 297 / 6e-103 Glutathione S-transferase, C-terminal-like;Translation elongation factor EF1B/ribosomal protein S6 (.1)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00736 EF1_GNE EF-1 guanine nucleotide exchange domain
Representative CDS sequence
>Potri.012G096400.4 pacid=42782758 polypeptide=Potri.012G096400.4.p locus=Potri.012G096400 ID=Potri.012G096400.4.v4.1 annot-version=v4.1
ATGGCAGTCGCTTTCTACGATCTCACCTCAGCCGCTGGCCTCAAGAAGCTCGATGACTATCTCCTTTCCCGCAGTTACATCTCAGGATACCAAGCCTCAA
AGGACGATCTCACTGTTTTTACAGCATTTTCAAGTGCACCAGCAGCTGAATACGTGAACGTGTCTCGGTGGTATACTCATATTGATGCGCTCTTGAGGAT
CTCTGGTGTTGAAGCTGAAGGGTGTGGAGTAGTAGTTGAGGGATCTGCTCCCATCACAAAGGAGGCAATTGCCACTCCTCCATCTGCAGACACAAAGGCT
GCTGCTGATGAGGATGATGATGATGATGATGATGTGGATCTGTTTGGTGAAGAGACCGAGGAGGAAAAGAAGGCTGCTGAAGAACGTGCAGCTACTATTA
AGGCTTCTTCAAAGAAGAAAGAGTCTGGCAAGTCATCTGTTTTGTTGGATGTGAAACCATGGGATGATGAGACTGACATGAAGAAGCTCGAGGAAGCAGT
CAGAAGTGTTGAGATGGAAGGTCTTTTTTGGGGAGCATCCAAGCTTGTACCTGTGGGATATGGCATTAAGAAAATGACAATCATGCTAACAATTGTTGAT
GACTTGGTCTCCGTGGACACTCTTATTGAGGAACGTCTGACAGTCGAACCCATCAACGAGTATGTCCAGAGTTGTGACATCGTGGCCTTCAACAAAATCT
AA
AA sequence
>Potri.012G096400.4 pacid=42782758 polypeptide=Potri.012G096400.4.p locus=Potri.012G096400 ID=Potri.012G096400.4.v4.1 annot-version=v4.1
MAVAFYDLTSAAGLKKLDDYLLSRSYISGYQASKDDLTVFTAFSSAPAAEYVNVSRWYTHIDALLRISGVEAEGCGVVVEGSAPITKEAIATPPSADTKA
AADEDDDDDDDVDLFGEETEEEKKAAEERAATIKASSKKKESGKSSVLLDVKPWDDETDMKKLEEAVRSVEMEGLFWGASKLVPVGYGIKKMTIMLTIVD
DLVSVDTLIEERLTVEPINEYVQSCDIVAFNKI

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT2G18110 Translation elongation factor... Potri.012G096400 0 1 Pt-EEF1.2
AT2G44050 COS1 coronatine insensitive1 suppre... Potri.017G001800 3.16 0.8208 Pt-COS1.2
AT5G35530 Ribosomal protein S3 family pr... Potri.018G049100 6.55 0.8599
AT3G13674 unknown protein Potri.018G082800 10.72 0.8111
AT2G29530 TIM10 Tim10/DDP family zinc finger p... Potri.009G039600 12.68 0.7718 TIM10.1
AT1G56070 LOS1, AT1G56075... LOW EXPRESSION OF OSMOTICALLY ... Potri.007G065700 14.42 0.8018 LOS1.1
AT3G04400 EMB2171 embryo defective 2171, Ribosom... Potri.010G066400 16.97 0.8113 Pt-RPL23.6
AT5G45775 Ribosomal L5P family protein (... Potri.006G181501 17.34 0.8031
AT3G26340 N-terminal nucleophile aminohy... Potri.008G177000 17.66 0.7876 Pt-PBE1.2
AT5G05780 RPN8A, AE3, ATH... ASYMMETRIC LEAVES ENHANCER 3, ... Potri.008G065300 18.00 0.7653
AT1G17880 ATBTF3 basic transcription factor 3 (... Potri.015G029800 20.19 0.8078

Potri.012G096400 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.