Pt-RPL17.1 (Potri.012G096600) [POPLAR]


External link
JGI Phytozome v13PopgenieAspWood                  
Symbol Pt-RPL17.1
Arabidopsis homologues
Locus ID BLAST score/e-value TF class Alias TAIR10 short description
AT1G27400 321 / 4e-114 Ribosomal protein L22p/L17e family protein (.1)
AT1G67430 315 / 1e-111 Ribosomal protein L22p/L17e family protein (.1.2)
Paralogs
Gene ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Potri.015G094400 362 / 3e-130 AT1G67430 324 / 4e-115 Ribosomal protein L22p/L17e family protein (.1.2)
Potri.010G060400 332 / 3e-118 AT1G67430 299 / 3e-105 Ribosomal protein L22p/L17e family protein (.1.2)
Potri.008G175500 329 / 4e-117 AT1G67430 285 / 1e-99 Ribosomal protein L22p/L17e family protein (.1.2)
Flax homologues
Locus ID BLAST score/e-value At best hit BLAST score/e-value TAIR10 short description
Lus10006421 325 / 2e-115 AT1G67430 315 / 1e-111 Ribosomal protein L22p/L17e family protein (.1.2)
Lus10015792 292 / 2e-94 AT1G67420 511 / 2e-168 Zn-dependent exopeptidases superfamily protein (.1.2)
Lus10037015 291 / 7e-93 AT1G67420 1104 / 0.0 Zn-dependent exopeptidases superfamily protein (.1.2)
PFAM info
Clan ID Clan name Pfam ID Pfam name Pfam description
PF00237 Ribosomal_L22 Ribosomal protein L22p/L17e
Representative CDS sequence
>Potri.012G096600.1 pacid=42782902 polypeptide=Potri.012G096600.1.p locus=Potri.012G096600 ID=Potri.012G096600.1.v4.1 annot-version=v4.1
ATGGTGAAGTATTCAAGAGAACCAGATAACCCCACCAAGTCCTGCAAAGCTAGGGGATCTGATCTCCGCGTTCACTTCAAGAATACAAGAGAGACTGCTT
TTTCAATCCGGAAATTGCCTTTGGGCAAGGCTAAAGGGTACTTGGAGGATGTTTTGGCACACAAGCAAGCTATTCCATTCCGCCGCTTCTGTCGTGGTGT
TGGGCGAACTGCTCAAGCTAAGAACCGCCATTCAAATGGACAAGGGCGGTGGCCTGCTAAATCTGCTAAATTCATCCTTGATTTGCTGAAGAATGCTGAA
AGCAACGCTGAGGTAAAAGGTTTGGATGTCGATGCACTTTACATATCACATATCCAAGTCAATCAAGCCCAAAAACAGCGTCGTCGTACTTACCGTGCCC
ATGGAAGGATCAATCCTTACATGTCATCGCCTTGCCACATTGAGTTGACTTTGTCAGAGAAGGAAGAGCCTGTCAAGAAAGAGGCTGATACACAGATTGC
TCCAAGGAAGCCCAAGGGTGCTCTTCGCAGTGGAGCTTCCTCCTGA
AA sequence
>Potri.012G096600.1 pacid=42782902 polypeptide=Potri.012G096600.1.p locus=Potri.012G096600 ID=Potri.012G096600.1.v4.1 annot-version=v4.1
MVKYSREPDNPTKSCKARGSDLRVHFKNTRETAFSIRKLPLGKAKGYLEDVLAHKQAIPFRRFCRGVGRTAQAKNRHSNGQGRWPAKSAKFILDLLKNAE
SNAEVKGLDVDALYISHIQVNQAQKQRRRTYRAHGRINPYMSSPCHIELTLSEKEEPVKKEADTQIAPRKPKGALRSGASS

DESeq2's median of ratios [POPLAR]

Mapped by: Order by: Show schematic diagram

Coexpressed genes

Only top 10 genes are shown Show allDownload tab-delimited text
Schematic diagram [FLAX] Schematic diagram [POPLAR]

*If you select 4 or less genes and then press "compare expression", expression will be shown as a graph. If you select more than 4 genes, expresion will be shown as a heat map.
*Color represents relative expression level among samples for each gene.
At best At TF class At alias At description Locus MR r Symbol NWA:WTNWB:WTNWA:OE-ARK2NWB:OE-ARK2NWA:miRNA-ARK2NWB:miRNA-ARK2NW 0hrWT H20WT-NWTUA1dEY NWTUA1dEY+TUB15 NWTUA1dY+TUB9 NWPde NWNWA:WT GANWBWT GATW:WTTW:WT GANWA:OE-ARK2 GANWB:OE-ARK2 GATW:OE-ARK2TW:OE-ARK2 GANWA:miRNA-ARK2 GANWB:miRNA-ARK2 GATW:miRNA-ARK2TW:miRNA-ARK2 GATW 2hrTW 8hrTW 24hrTW 48hrTW 96hrTW 336hrWT ACC35S::etr1-1 H2035S::etr1-1 ACCLMX5::etr1-1 H20LMX5::etr1-1 ACCWT-TWTUA1dEY TWTUA1dEY+TUB15 TWTUA1dY+TUB9 TWPde TWOW:WTOW:WT GAOW:OE-ARK2OW:OE-ARK2 GAOW:miRNA-ARK2OW:miRNA-ARK2 GAOW 2hrOW 8hrOW 24hrOW 48hrOW 96hrOW 336hrRoot CTRRoot LongColdRoot LongDrougtRoot LongHeatRoot LongSaltRoot ShortColdRoot ShortDrougtRoot ShortHeatRoot ShortSaltPtr rootLeaf CTRLeaf LongColdLeaf LongDrougtLeaf LongHeatLeaf LongSaltLeaf ShortColdLeaf ShortDrougtLeaf ShortHeatLeaf ShortSaltPtr leafStem CTRStem LongColdStem LongDrougtStem LongHeatStem LongSaltStem ShortColdStem ShortDrougtStem ShortHeatStem ShortSaltPtr shootPtr xylemPtr phloemPtr fiberPtr vesselPtr fiber vessel ray
AT1G27400 Ribosomal protein L22p/L17e fa... Potri.012G096600 0 1 Pt-RPL17.1
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G453900 1.73 0.9664
AT3G09630 Ribosomal protein L4/L1 family... Potri.016G084400 2.00 0.9652 Pt-RPL4.2
AT3G55280 RPL23A2, RPL23A... RIBOSOMAL PROTEIN L23A2, ribos... Potri.016G079800 2.23 0.9555
AT5G60390 GTP binding Elongation factor ... Potri.008G042500 4.58 0.9580 ADR12.1
AT1G18080 RACK1A_AT, ATAR... RECEPTOR FOR ACTIVATED C KINAS... Potri.015G041600 4.89 0.9518 Pt-GBF1.2
AT2G27530 PGY1 PIGGYBACK1, Ribosomal protein ... Potri.007G034800 5.29 0.9559
AT3G53020 RPL24B, STV1 SHORT VALVE1, Ribosomal protei... Potri.012G139400 7.74 0.9481
AT3G20000 TOM40 translocase of the outer mitoc... Potri.014G004100 8.12 0.9463
AT1G33140 PGY2 PIGGYBACK2, Ribosomal protein ... Potri.001G454000 9.16 0.9522
AT5G35530 Ribosomal protein S3 family pr... Potri.018G049100 10.09 0.9140

Potri.012G096600 coexpression network

*The number of genes in the network is adjusted within 50 genes.
*Gene name represents symbol(s) of closest Arabidopsis gene if symbol(s) for the gene itself doesn't exist.
*Circle diameter represents the number of connection with other genes within this network.
*Color for gene name represents subnetwork based on the result of network clustering.